Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Venanprubart Biosimilar – Anti-B- and T-lymphocyte attenuator mAb – Research Grade

  • PX-TA2147-100
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $314.00.Current price is: $238.00.

100ug 24% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade

Product name PX-TA2147-50
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody
Product name Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade
Uniprot ID Q7Z6A9
Source CAS: 2635407-50-8
Origin species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2147
Note For research use only. Not suitable for human use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Venanprubart Biosimilar is a monoclonal antibody (mAb) that targets the B- and T-lymphocyte attenuator (BTLA) protein. It is a research grade antibody that has been developed as a biosimilar to the original anti-BTLA mAb, which has shown promising results in clinical trials for the treatment of various autoimmune and inflammatory diseases.

Structure of Venanprubart Biosimilar

Venanprubart Biosimilar is a fully humanized IgG1 monoclonal antibody that is produced using recombinant DNA technology. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab regions are responsible for binding to the BTLA protein, while the Fc region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Mechanism of Action

BTLA is a co-inhibitory receptor that is expressed on the surface of B and T lymphocytes. It interacts with its ligand, herpesvirus entry mediator (HVEM), to downregulate immune responses. In autoimmune and inflammatory diseases, the BTLA-HVEM pathway is often dysregulated, leading to excessive immune activation. Venanprubart Biosimilar binds to BTLA, preventing its interaction with HVEM and thereby blocking the inhibitory signal. This results in the activation of B and T cells, leading to a reduction in disease symptoms.

Therapeutic Target

The therapeutic target of Venanprubart Biosimilar is BTLA, a protein that plays a crucial role in regulating immune responses. BTLA is expressed on the surface of B and T cells, as well as natural killer (NK) cells and dendritic cells. It is involved in maintaining immune homeostasis and tolerance, and dysregulation of this pathway has been implicated in the pathogenesis of various autoimmune and inflammatory diseases. By targeting BTLA, Venanprubart Biosimilar aims to restore the balance of the immune system and treat these diseases.

Applications of Venanprubart Biosimilar

Venanprubart Biosimilar has shown promising results in preclinical studies for the treatment of multiple sclerosis, rheumatoid arthritis, and inflammatory bowel disease. In a phase I clinical trial, the original anti-BTLA mAb has been shown to be safe and well-tolerated in healthy volunteers, and a phase II trial is currently ongoing to evaluate its efficacy in multiple sclerosis patients. Based on these results, Venanprubart Biosimilar is being developed as a potential treatment for these and other autoimmune and inflammatory diseases.

Advantages of Venanprubart Biosimilar

As a biosimilar, Venanprubart Biosimilar offers several advantages over the original anti-BTLA mAb. It has the same amino acid sequence and structure as the reference product, ensuring similar efficacy and safety profiles. However, as a research grade antibody, it is more affordable and accessible for use in preclinical and clinical studies. Additionally, the use of a fully humanized antibody reduces the risk of immunogenicity, making it a safer option for patients.

Conclusion

In summary, Venanprubart Biosimilar is a research grade monoclonal antibody that targets the BTLA protein, a key regulator of immune responses. By blocking the inhibitory signal of BTLA, it aims to treat autoimmune and inflammatory diseases. With promising preclinical and early clinical data, Venanprubart Biosimilar has the potential to become a valuable therapeutic option for patients suffering from these conditions.

SDS-PAGE for Research Grade Venanprubart

SDS-PAGE for Research Grade Venanprubart

Research Grade Venanprubart, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Research Grade Venanprubart

Flow Cytometry results for Research Grade Venanprubart

Target Cells were stained with an irrelevant antibody or Research Grade Venanprubart at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Venanprubart Biosimilar - Anti-B- and T-lymphocyte attenuator mAb - Research Grade

There are no reviews yet.

Be the first to review “Venanprubart Biosimilar – Anti-B- and T-lymphocyte attenuator mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products