Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD197/CCR7 VHH (SAA1349)

Note:
For research use only. Not suitable for human use.

Original price was: $588.00.Current price is: $452.00.

100ug 23% OFF + 452 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
SDS-PAGE for Anti-Human CD197/CCR7 VHH (SAA1349)
Anti-Human CD197/CCR7 VHH (SAA1349)

Anti-Human CD197/CCR7 VHH (SAA1349)

Product name ARO-A16382-100
Uniprot ID P32248
Raw Antigen Sequence MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CDw197, anti-EVI1, anti-CMKBR7, anti-CCR7, anti-C-C CKR-7, anti-CD197, anti-CCR-7, anti-Epstein-Barr virus-induced G-protein coupled receptor 1, anti-MIP-3 beta receptor, anti-EBI1, anti-CC-CKR-7, anti-BLR2, anti-EBV-induced G-protein coupled receptor 1, anti-C-C chemokine receptor type 7
Reference ARO-A16382
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD197/CCR7
Clone Name SAA1349
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16382-1MG
Uniprot ID P32248
Raw Antigen Sequence MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CDw197, anti-EVI1, anti-CMKBR7, anti-CCR7, anti-C-C CKR-7, anti-CD197, anti-CCR-7, anti-Epstein-Barr virus-induced G-protein coupled receptor 1, anti-MIP-3 beta receptor, anti-EBI1, anti-CC-CKR-7, anti-BLR2, anti-EBV-induced G-protein coupled receptor 1, anti-C-C chemokine receptor type 7
Reference ARO-A16382
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD197/CCR7
Clone Name SAA1349
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16382-50
Uniprot ID P32248
Raw Antigen Sequence MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMSFCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CDw197, anti-EVI1, anti-CMKBR7, anti-CCR7, anti-C-C CKR-7, anti-CD197, anti-CCR-7, anti-Epstein-Barr virus-induced G-protein coupled receptor 1, anti-MIP-3 beta receptor, anti-EBI1, anti-CC-CKR-7, anti-BLR2, anti-EBV-induced G-protein coupled receptor 1, anti-C-C chemokine receptor type 7
Reference ARO-A16382
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD197/CCR7
Clone Name SAA1349
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Human CD197/CCR7 VHH (SAA1349)

SDS-PAGE for Anti-Human CD197/CCR7 VHH (SAA1349)

Anti-Human CD197/CCR7 VHH (SAA1349), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD197/CCR7 VHH (SAA1349)

There are no reviews yet.

Be the first to review “Anti-Human CD197/CCR7 VHH (SAA1349)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products