Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | CD20 Protein - Human CD20 Recombinant Protein |
---|---|
Uniprot ID | P11836 |
Uniprot link | http://www.uniprot.org/uniprot/P11836 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGSHHHHHHSGENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPE PPQDQESSPIENDSSP |
Molecular weight | 10.98 kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | 90% |
Buffer | PBS,pH 7.5 |
Form | Frozen |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Fragment Type | Glu213-Pro297 |
NCBI Reference | P11836 |
Aliases /Synonyms | B-lymphocyte antigen CD20, B-lymphocyte surface antigen B1, Bp35, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, CD_antigen: CD20, MS4A1 |
Reference | PX-P3060 |
Note | For research use only |
Cd20 protein is a 33-37 kDa polypeptide encoded by the MS4A1 gene in humans. The protein has three transmembrane hydrophobic regions. The 85 amino acid carboxyl terminal regions of the protein is located within the cytoplasm. The length of this region in particular contrasts with the structure of other B-cell specific structures such as IgM, IgD, IgG heavy chains. Due to its multiple membrane spanning, the protein structure of CD20 resembles to that of an ion channel. There are multiple forms of CD20 proteins which derive from different CD20 phosphorylation patterns. The human CD20 protein has four transmembrane protein and is not glycosylated. The protein has no known major sequence homology to other proteins.
The precised physiological role of the proteins remains unknown, however, it has been shown that the protein is involved in the regulation of B-cell activation, proliferation and differentiation. The CD20 protein is expressed on the surface of B-cells. CD20 protein has no known ligand. However, its function is to unable B-cell immune response, particularly against T-independent ligands. Their expression is upmodulated upon B-cell activation.
The protein is also expressed at the surface germinal center cells and mantel cells of the lymph node. CD20 is also dimly expressed by a subset of T lymphocytes displaying CD8+, CD28+, CD38+, CD45RO+, TCR+, HLA-DR-phenotype which has been described in bone marrow and peripheral blood.
CD20 protein is also present in follicular dendric cells.
CD20 has been reported to be linked to:
• Neoplastic diseases of B cell precursor
• Neoplastic diseases of T cell precursor
• Acute Leukemias
• Neoplastic diseases of mature B cells
• Neoplastic diseases of mature T and NK cells
Related products
Send us a message from the form below
Reviews
There are no reviews yet.