Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | size | 100ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Mammalian cells | 
| Applications | Elisa, WB | 
| Product name | CD52 Recombinant Protein | 
|---|---|
| Uniprot ID | P31358 | 
| Uniprot link | http://www.uniprot.org/uniprot/P31358 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Eukaryotic expression | 
| Sequence | MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPS | 
| Molecular weight | 40kDa | 
| Protein delivered with Tag? | C-terminal Fc Tag | 
| Purity estimated | >90% by SDS-PAGE | 
| Buffer | PBS pH7.5 | 
| Delivery condition | Dry Ice | 
| Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. | 
| Brand | ProteoGenix | 
| Host species | Mammalian cells | 
| Fragment Type | Met1-Ser36 | 
| Aliases /Synonyms | CDW52, HE5 | 
| Reference | PX-P4084 | 
| Note | For research use only | 
CD52 / CDW52 are small glycosyl phosphatidylinositol (GPI) anchor glycoproteins. It has a mature peptide containing only 12 amino acids and is expressed in large numbers on human lymphocytes. From a clinical point of view, this protein is an important target for therapeutic intervention for leukopenia in haematological neoplasms and post transplant immunosuppression. CD52 / CDW52 may play a role in carbohydrate transport and targeting. It is an excellent target for complement mediated cell lysis.
Send us a message from the form below
Reviews
There are no reviews yet.