Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | CD91 Recombinant Protein |
---|---|
Uniprot ID | Q07954 |
Uniprot link | http://www.uniprot.org/uniprot/Q07954 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
Molecular weight | 37kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Ala20~Gly292 |
Aliases /Synonyms | A2MR,APR |
Reference | PX-P4094 |
Note | For research use only |
The 1 receptor of the related 1-lipoprotein protein (LRP1), also known as alpha-2-macroglobulin receptor (A2MR), apolipoprotein E receptor (APOER) or differentiation cluster 91 (CD91), is a Protein forming a receptor, which is present in cells and participate in receptor-mediated endocytosis. In humans, the LRP1 protein is encoded by the LRP1 gene. LRP1 is also a key signaling protein and is therefore involved in several biological processes, such as lipoprotein metabolism and cell movement, as well as neurodegenerative diseases, atherosclerosis and cancer.
CD91 Recombinant Protein on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is superior than 90 %
Send us a message from the form below
Reviews
There are no reviews yet.