Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | CD91 Recombinant Protein |
---|---|
Uniprot ID | Q07954 |
Uniprot link | http://www.uniprot.org/uniprot/Q07954 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | AIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
Molecular weight | 37kDa |
Protein delivered with Tag? | N-terminal His Tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH7.5 |
Delivery condition | Dry Ice |
Storage condition | Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Ala20~Gly292 |
Aliases /Synonyms | A2MR,APR |
Reference | PX-P4094 |
Note | For research use only |
The 1 receptor of the related 1-lipoprotein protein (LRP1), also known as alpha-2-macroglobulin receptor (A2MR), apolipoprotein E receptor (APOER) or differentiation cluster 91 (CD91), is a Protein forming a receptor, which is present in cells and participate in receptor-mediated endocytosis. In humans, the LRP1 protein is encoded by the LRP1 gene. LRP1 is also a key signaling protein and is therefore involved in several biological processes, such as lipoprotein metabolism and cell movement, as well as neurodegenerative diseases, atherosclerosis and cancer.
Send us a message from the form below
Reviews
There are no reviews yet.