Cart (0 Items)
Your cart is currently empty.
View Products
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | E. coli ArsR Nter FLAG and Cter His Recombinant Protein |
|---|---|
| Origin species | E. coli |
| Expression system | Prokaryotic expression |
| Sequence | MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH |
| Molecular weight | 15,33 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% (DENATURED) |
| Buffer | PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | ZP_03049476.1 |
| NCBI Reference | ZP_03049476.1 |
| Aliases /Synonyms | ArsR E coli optimized, arsenical resistance operon repressor |
| Reference | PX-P1071 |
| Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.