Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | E. coli ArsR Nter FLAG and Cter His Recombinant Protein |
---|---|
Origin species | E. coli |
Expression system | Prokaryotic expression |
Sequence | MDYKDDDDKGSFLLPIQLFKILADETRLGIVLLLSELGELCVCDLCTALDQSQPKISRHLALLRESGLLLDRKQGKWVHY RLSPHIPAWAAKIIDEAWRCEQEKVQAIVRNLARQNCSGDSKNICSLEHHHHHH |
Molecular weight | 15,33 kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 80% (DENATURED) |
Buffer | PBS, 300mM in native conditions. PBS, Urea 8M, imidazole 10mM in denaturing conditions |
Form | liquid |
Delivery condition | Dry Ice |
Delivery lead time in business days | 10-25 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Protein Accession | ZP_03049476.1 |
NCBI Reference | ZP_03049476.1 |
Aliases /Synonyms | ArsR E coli optimized, arsenical resistance operon repressor |
Reference | PX-P1071 |
Note | For research use only |
Related products
Send us a message from the form below
Reviews
There are no reviews yet.