Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: $409.00.Current price is: $308.00.

50ug 25% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

Product name Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1894-50
Uniprot ID P01920
Source DQB1-FL8, LG11
Species Humanized
Raw Antigen Sequence MSWKKALRIPGGLRAATVTLMLAMLSTPVAEGRDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKMLSGIGGFVLGLIFLGLGLIIHHRSQKGLLH
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-DQB,MHC class II antigen DQB1,HLA-DQB1,HLA class II histocompatibility antigen,DQ beta 1 chain,LG11,DQB1-FL8, LG11
Reference PX-TA1894
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction to Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb

Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb is a monoclonal antibody that specifically targets the human leukocyte antigen-DQB1 (HLA-DQB1) molecule. This biosimilar is a research grade therapeutic agent that has shown promising results in pre-clinical studies for the treatment of various autoimmune diseases.

Structure of Humanized DQB1-FL8 Biosimilar

Humanized DQB1-FL8 Biosimilar is a recombinant monoclonal antibody that has been engineered to have a humanized structure. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the HLA-DQB1 molecule, while the constant regions provide stability and effector functions.

Activity of Humanized DQB1-FL8 Biosimilar

Humanized DQB1-FL8 Biosimilar specifically targets the HLA-DQB1 molecule, which is a major histocompatibility complex class II protein. HLA-DQB1 is expressed on the surface of antigen-presenting cells and plays a crucial role in the activation of T cells. By binding to HLA-DQB1, Humanized DQB1-FL8 Biosimilar blocks the interaction between HLA-DQB1 and T cells, thereby preventing the activation of the immune response.

Application of Humanized DQB1-FL8 Biosimilar

Humanized DQB1-FL8 Biosimilar has shown promising results in pre-clinical studies for the treatment of various autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and type 1 diabetes. These diseases are characterized by an overactive immune response, and the targeting of HLA-DQB1 with Humanized DQB1-FL8 Biosimilar has the potential to suppress this response and alleviate symptoms.

Rheumatoid Arthritis: Rheumatoid arthritis (RA) is an autoimmune disorder characterized by inflammation of the joints. HLA-DQB1 has been implicated in the pathogenesis of RA, and studies have shown that Humanized DQB1-FL8 Biosimilar can effectively inhibit the immune response in RA animal models.

Multiple Sclerosis: Multiple sclerosis (MS) is an autoimmune disorder that affects the central nervous system. HLA-DQB1 has been identified as a genetic risk factor for MS, and Humanized DQB1-FL8 Biosimilar has been shown to reduce disease severity and delay disease progression in MS animal models.

Type 1 Diabetes: Type 1 diabetes (T1D) is an autoimmune disorder in which the immune system attacks and destroys insulin-producing beta cells in the pancreas. HLA-DQB1 has been implicated in the development of T1D, and studies have shown that Humanized DQB1-FL8 Biosimilar can prevent the destruction of beta cells and preserve insulin production in T1D animal models.

Conclusion

Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb is a promising research grade therapeutic agent for the treatment of autoimmune diseases. Its unique ability to specifically target HLA-DQB1 makes it a potential candidate for the development of novel treatments for diseases such as rheumatoid arthritis, multiple sclerosis, and type 1 diabetes. Further clinical studies are needed to fully evaluate the safety and efficacy of this biosimilar in human patients.

SDS-PAGE for Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

SDS-PAGE for Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humanized DQB1-FL8 Biosimilar - Anti-HLA-DQB mAb - Research Grade

There are no reviews yet.

Be the first to review “Humanized DQB1-FL8 Biosimilar – Anti-HLA-DQB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products