Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Humanized HLA-G-0104 Biosimilar – Anti-HLA-G mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1

Original price was: $388.00.Current price is: $308.00.

50ug 21% OFF + 308 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

Product name Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name PX-TA1895-50
Uniprot ID P17693
Source HLA-G-0104, HLA-G-0031
Species Humanized
Raw Antigen Sequence MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-HLA-G,HLAG,sHLA-G,HLA G antigen,MHC class I antigen G,HLA-6.0,HLA class I histocompatibility antigen,alpha chain G,HLA-G-0031,HLA-G-0104, HLA-G-0031
Reference PX-TA1895
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

Introduction

Humanized HLA-G-0104 Biosimilar, also known as Anti-HLA-G mAb, is a monoclonal antibody that is designed to target the human leukocyte antigen-G (HLA-G) protein. This biosimilar is a research grade antibody that has been developed to mimic the activity of the natural HLA-G protein and has potential therapeutic applications in various diseases.

Structure of Humanized HLA-G-0104 Biosimilar

Humanized HLA-G-0104 Biosimilar is a recombinant, humanized monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions are responsible for binding to the HLA-G protein, while the constant regions determine the antibody’s effector functions.

Activity of Humanized HLA-G-0104 Biosimilar

The main activity of Humanized HLA-G-0104 Biosimilar is to bind to the HLA-G protein, which is expressed on the surface of various cells, including immune cells, placental cells, and tumor cells. By binding to HLA-G, this biosimilar can modulate immune responses and regulate the function of immune cells.

One of the major functions of HLA-G is to induce immune tolerance, which is essential for maintaining a healthy pregnancy. Humanized HLA-G-0104 Biosimilar can mimic this function and has the potential to be used as a therapeutic agent in pregnancy-related complications, such as recurrent miscarriage and pre-eclampsia.

Moreover, HLA-G has been found to be overexpressed in various types of cancer, and its expression is associated with tumor progression and immune evasion. By targeting HLA-G, Humanized HLA-G-0104 Biosimilar can potentially inhibit tumor growth and enhance the anti-tumor immune response.

Application of Humanized HLA-G-0104 Biosimilar

Due to its ability to modulate immune responses, Humanized HLA-G-0104 Biosimilar has potential applications in various diseases, including pregnancy-related complications, cancer, and autoimmune diseases.

In pregnancy-related complications, this biosimilar can be used to prevent recurrent miscarriage, pre-eclampsia, and other pregnancy-related disorders by inducing immune tolerance and regulating the function of immune cells.

In cancer, Humanized HLA-G-0104 Biosimilar can be used as a therapeutic agent to inhibit tumor growth and enhance the anti-tumor immune response. It can also be used in combination with other cancer therapies to improve their efficacy.

In autoimmune diseases, HLA-G has been found to play a role in regulating immune responses and preventing autoimmune reactions. Humanized HLA-G-0104 Biosimilar can potentially be used to treat autoimmune diseases by modulating immune responses and reducing inflammation.

Conclusion

Humanized HLA-G-0104 Biosimilar, also known as Anti-HLA-G mAb, is a recombinant, humanized monoclonal antibody that targets the HLA-G protein. It has potential therapeutic applications in various diseases, including pregnancy-related complications, cancer, and autoimmune diseases. By mimicking the activity of the natural HLA-G protein, this biosimilar can modulate immune responses and regulate the function of immune cells. Further research and clinical trials are needed to fully understand the potential of Humanized HLA-G-0104 Biosimilar as a therapeutic agent.

SDS-PAGE for Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

SDS-PAGE for Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Humanized HLA-G-0104 Biosimilar - Anti-HLA-G mAb - Research Grade

There are no reviews yet.

Be the first to review “Humanized HLA-G-0104 Biosimilar – Anti-HLA-G mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products