Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human BAFF – TNFSF13B – CD257 recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human BAFF - TNFSF13B - CD257 recombinant protein |
|---|---|
| Uniprot ID | Q9Y275 |
| Uniprot link | http://www.uniprot.org/uniprot/Q9Y275 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MKHLWFFLLLVAAPRWVLSAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLLGSHHHHHH |
| Molecular weight | 20.28kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 50% |
| Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Partial |
| Aliases /Synonyms | BLyS, TNFSF13B, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, Dendritic cell-derived TNF-like molecule, TNF- and APOL-related leukocyte expressed ligand 1, TALL-1, CD257,BAFF, BLYS, TALL1, TNFSF20, ZTNF4 |
| Reference | PX-P4012 |
| Note | For research use only |
Related products
Biosimilar
Belimumab Biosimilar – Anti-TNFSF13B, CD257 mAb – Research Grade
PX-TA1191 238$
Biosimilar
Tabalumab Biosimilar – Anti-TNFSF13B, CD257 mAb – Research Grade
PX-TA1275 238$
Biosimilar
Tibulizumab Biosimilar – Anti-IL17A, TNFSF13B, CD257 mAb – Research Grade
PX-TA1494 238$Contact us
Send us a message from the form below
Reviews
There are no reviews yet.