Cart (0 Items)
Your cart is currently empty.
View Products 
               
               
              | Size | 100ug, 50ug | 
|---|---|
| Brand | ProteoGenix | 
| Product type | Recombinant Proteins | 
| Host Species | Escherichia coli (E. coli) | 
| Applications | Elisa, WB | 
| Product name | Human CD40 ligand recombinant protein | 
|---|---|
| Uniprot ID | P63304 | 
| Uniprot link | http://www.uniprot.org/uniprot/P63304 | 
| Origin species | Homo sapiens (Human) | 
| Expression system | Prokaryotic expression | 
| Sequence | MENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQ APFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKLLEHHH HHH | 
| Molecular weight | 17.95kDa | 
| Protein delivered with Tag? | Yes | 
| Purity estimated | 85% | 
| Buffer | 50 mM Tris-HCl, pH 8.0, 150 mM NaCl | 
| Form | Lyophilized | 
| Delivery condition | Dry Ice | 
| Delivery lead time in business days | 5-7 | 
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) | 
| Brand | ProteoGenix | 
| Host species | Escherichia coli (E.coli) | 
| Fragment Type | Partial | 
| Aliases /Synonyms | CD40L, CD154, TRAP, HIGM1, IGM, IMD3, TBAM, T-BAM, TNFSF5, Gp39, TNF Superfamily Member 5, Hyper-IgM Syndrome, TNF-Related Activation Protein, T-Cell B-Cell Activating Molecule | 
| Reference | PX-P4016 | 
| Note | For research use only | 
Related products
Send us a message from the form below
Reviews
There are no reviews yet.