Cart (0 Items)
Your cart is currently empty.
View ProductsSize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Human IL33 isoform 1 partial (112-270) recombinant protein |
---|---|
Uniprot ID | O95760 |
Uniprot link | http://www.uniprot.org/uniprot/O95760 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | MGSHHHHHHSGDDDDKMSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET |
Molecular weight | 19.92kDa |
Protein delivered with Tag? | Yes |
Purity estimated | 85% |
Buffer | PBS, pH 7.5 |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Partial |
Aliases /Synonyms | DV27, C9ORF26, IL1F11, NFHEV, Interleukin-1 Family, Member 11, Nuclear factor from high endothelial venules, Interleukin 33, IL33,IL33 isoform 1 partial (112-270) |
Reference | PX-P4020 |
Note | For research use only |
Human IL33 isoform 1 partial (112-270) recombinant protein, also known as interleukin-33, is a cytokine protein that plays a crucial role in the regulation of immune responses and inflammatory processes. It is a member of the IL-1 family and is produced by various cell types such as epithelial cells, fibroblasts, and endothelial cells in response to tissue damage or infection. This protein has been extensively studied for its potential as a drug target in various diseases, and its structure, activity, and applications have been thoroughly investigated.
The human IL33 isoform 1 partial (112-270) recombinant protein is a 31 kDa protein consisting of 270 amino acids. It contains a pro-inflammatory domain, a nuclear localization sequence, and a helical cytokine domain. The pro-inflammatory domain is responsible for the activation of immune cells, while the nuclear localization sequence allows the protein to enter the nucleus and regulate gene expression. The helical cytokine domain is responsible for binding to its receptor, ST2, and initiating signaling pathways.
The crystal structure of human IL33 has been determined, revealing a unique structural fold with a central β-sheet surrounded by α-helices. This structure is similar to other members of the IL-1 family, but with some distinct differences. The unique structure of human IL33 allows it to interact with its receptor and other signaling molecules in a specific manner, leading to the activation of immune responses.
Human IL33 isoform 1 partial (112-270) recombinant protein is a potent activator of immune cells, particularly type 2 helper T cells (Th2). It has been shown to induce the production of cytokines such as IL-5 and IL-13, which are involved in allergic responses and inflammation. It also promotes the activation and proliferation of mast cells and eosinophils, which play a crucial role in allergic reactions. Additionally, human IL33 has been found to induce the production of chemokines, which attract immune cells to the site of inflammation or infection.
Besides its role in immune responses, human IL33 has also been shown to have a protective effect on tissues and organs. It has been found to promote tissue repair and regeneration by stimulating the production of growth factors and anti-inflammatory cytokines. This activity of human IL33 makes it a potential therapeutic target for tissue damage and diseases such as asthma, rheumatoid arthritis, and inflammatory bowel disease.
The potential of human IL33 as a drug target has been extensively studied, and several therapeutic applications have been proposed. One of the most promising applications of human IL33 is in the treatment of allergic diseases. As an activator of Th2 cells and other immune cells involved in allergic responses, inhibiting human IL33 could potentially reduce the severity of allergic reactions and provide relief for patients suffering from conditions such as asthma and atopic dermatitis.
Human IL33 has also been investigated as a potential target for autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. By blocking the activity of human IL33, the excessive immune response that leads to tissue damage in these diseases could be reduced. Additionally, human IL33 has been found to play a role in cancer progression and metastasis, making it a potential target for cancer therapy.
In conclusion, Human IL33 isoform 1 partial (112-270) recombinant protein is a cytokine with diverse functions in the regulation of immune responses and tissue repair.
Send us a message from the form below
Reviews
There are no reviews yet.