Skip to main content

🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25

📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools

Explore Now

Human TIVAMP Human Recombinant Protein

Reference:
Size

100ug, 50ug

Brand

ProteoGenix

Product type

Recombinant Proteins

Host Species

Escherichia coli (E. coli)

Applications

Elisa, WB

Product nameHuman TIVAMP Human Recombinant Protein
Uniprot IDP51809
Uniprot linkhttp://www.uniprot.org/uniprot/P51809
Origin speciesHomo sapiens (Human)
Expression systemProkaryotic expression
SequenceMASWSHPQFEKGALEVLFQGPGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQD RIVYLCITDDDFERSRAFIFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKG IMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKALVPRGSSAHHHHHHHHHHH
Molecular weight26,11 kDa
Protein delivered with Tag?Yes
Purity estimated90%
BufferNaH2PO4 100mM, TrisHCl 10mM, Urea 8M
Formliquid
Delivery conditionDry Ice
Delivery lead time in business days10-25
Storage condition4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
BrandProteoGenix
Host speciesEscherichia coli (E.coli)
Fragment TypePartial
Protein AccessionNP_005629.1
Spec:Entrez GeneID6845
Spec:NCBI Gene AliasesSYBL1, TI-VAMP, VAMP-7, TIVAMP
Spec:SwissProtIDP51809
NCBI ReferenceNP_005629.1
Aliases /SynonymsTIVAMP Human, vesicle-associated membrane protein 7 isoform 1
ReferencePX-P1161
NoteFor research use only

Description of Human TIVAMP Human Recombinant Protein

Introduction

Human TIVAMP is a human recombinant protein that has gained significant attention in the field of drug development due to its potential as a therapeutic target. This protein has been extensively studied for its structure, activity, and application, and has shown promising results in various disease models. In this article, we will discuss the key features of Human TIVAMP and its potential as a drug target.

Structure of Human TIVAMP

Human TIVAMP is a transmembrane protein that is primarily expressed in the brain and spinal cord. It belongs to the family of voltage-gated ion channels and is composed of four subunits, each containing six transmembrane segments. The subunits are arranged in a tetrameric structure, forming a central pore that allows the passage of ions across the cell membrane.

The primary structure of Human TIVAMP is highly conserved among different species, indicating its crucial role in cellular function. However, its tertiary structure has been found to be dynamic, allowing for conformational changes that regulate its activity.

Activity of Human TIVAMP

Human TIVAMP is a calcium channel that plays a crucial role in regulating intracellular calcium levels. It is activated by membrane depolarization, leading to the influx of calcium ions into the cell. This influx of calcium triggers various physiological processes such as neurotransmitter release, muscle contraction, and gene expression.

Studies have shown that dysregulation of Human TIVAMP activity is associated with various diseases, including epilepsy, migraine, and ataxia. Therefore, targeting this protein has become a promising approach for the treatment of these disorders.

Application of Human TIVAMP

As a drug target, Human TIVAMP has shown great potential in the treatment of neurological disorders. Several small molecule inhibitors have been developed to target this protein, with promising results in preclinical studies. These inhibitors have been found to effectively reduce the activity of Human TIVAMP, leading to a decrease in calcium influx and subsequent improvement in disease symptoms.

In addition to its role in neurological disorders, Human TIVAMP has also been implicated in cancer progression. It has been shown to promote tumor growth and metastasis by regulating calcium signaling pathways. Therefore, targeting this protein may also have potential applications in cancer treatment.

Conclusion

In summary, Human TIVAMP is a crucial protein involved in regulating intracellular calcium levels. Its dysregulation has been linked to various diseases, making it a promising drug target. The structure of Human TIVAMP, with its dynamic tertiary conformation, allows for the development of specific inhibitors that can effectively regulate its activity. With ongoing research and development, Human TIVAMP may hold the key to treating a wide range of diseases, making it an exciting area of study in the field of drug development.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human TIVAMP Human Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade
Biosimilar

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade

PX-TA1011 238$
Utomilumab Biosimilar – Anti-Human TNFRSF9 mAb – Research Grade
Biosimilar

Utomilumab Biosimilar – Anti-Human TNFRSF9 mAb – Research Grade

PX-TA1012 238$
Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade
Biosimilar

Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade

PX-TA1100 238$
cBR96 Biosimilar – Anti-Lewis Y mAb – Research Grade
Biosimilar

cBR96 Biosimilar – Anti-Lewis Y mAb – Research Grade

PX-TA1108 238$
RSV-neutralizing Human Antibody  Biosimilar – Anti-Respipatory syncytial virus mAb – Research Grade
Biosimilar

RSV-neutralizing Human Antibody Biosimilar – Anti-Respipatory syncytial virus mAb – Research Grade

PX-TA1628 238$
Penpulimab  Biosimilar – Anti-Pd-1 mAb – Research Grade
Biosimilar

Penpulimab Biosimilar – Anti-Pd-1 mAb – Research Grade

PX-TA1638 238$
Alomfilimab Biosimilar – Anti-ICOS mAb – Research Grade
Biosimilar

Alomfilimab Biosimilar – Anti-ICOS mAb – Research Grade

PX-TA1641 238$
Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade
Biosimilar

Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade

PX-TA1646 238$
Depemokimab Biosimilar – Anti-IL5 mAb – Research Grade
Biosimilar

Depemokimab Biosimilar – Anti-IL5 mAb – Research Grade

PX-TA1656 238$
Divozilimab Biosimilar – Anti-MS4A1 mAb – Research Grade
Biosimilar

Divozilimab Biosimilar – Anti-MS4A1 mAb – Research Grade

PX-TA1657 238$
Ebdarokimab Biosimilar – Anti-IL12B mAb – Research Grade
Biosimilar

Ebdarokimab Biosimilar – Anti-IL12B mAb – Research Grade

PX-TA1660 238$
Idactamab Biosimilar – Anti-SLC1A5 mAb – Research Grade
Biosimilar

Idactamab Biosimilar – Anti-SLC1A5 mAb – Research Grade

PX-TA1673 238$
Imsidolimab Biosimilar – Anti-IL36R mAb – Research Grade
Biosimilar

Imsidolimab Biosimilar – Anti-IL36R mAb – Research Grade

PX-TA1674 238$

Contact us

Send us a message from the form below







    Cart (0 Items)

    Your cart is currently empty.

    View Products