Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human TIVAMP Human Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Human TIVAMP Human Recombinant Protein |
|---|---|
| Uniprot ID | P51809 |
| Uniprot link | http://www.uniprot.org/uniprot/P51809 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | MASWSHPQFEKGALEVLFQGPGMAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQD RIVYLCITDDDFERSRAFIFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENKGLDKVMETQAQVDELKG IMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCMKNLKALVPRGSSAHHHHHHHHHHH |
| Molecular weight | 26,11 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | NaH2PO4 100mM, TrisHCl 10mM, Urea 8M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | NP_005629.1 |
| Spec:Entrez GeneID | 6845 |
| Spec:NCBI Gene Aliases | SYBL1, TI-VAMP, VAMP-7, TIVAMP |
| Spec:SwissProtID | P51809 |
| NCBI Reference | NP_005629.1 |
| Aliases /Synonyms | TIVAMP Human, vesicle-associated membrane protein 7 isoform 1 |
| Reference | PX-P1161 |
| Note | For research use only |
Related products
Biosimilar
Tecnemab Biosimilar – Anti-CSPG4, HMW-MAA, CD3E, ERBB2, toxin mAb – Research Grade
PX-TA1100 238$
Biosimilar
RSV-neutralizing Human Antibody Biosimilar – Anti-Respipatory syncytial virus mAb – Research Grade
PX-TA1628 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.