Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade

  • PX-TA1011-50
  • Validated ELISA
Isotype:
IgG1

Original price was: $132.00.Current price is: $100.00.

50ug 24% OFF + 100 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name PX-TA1011-50
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody
Product name Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade
Uniprot ID P29460
Source DrugBank DB05679
Species Human
Raw Antigen Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 148kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ustekinumab,Ustekinumab,Human IL-12 IL-23,anti-Human IL-12 IL-23
Reference PX-TA1011
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1
Clonality Monoclonal Antibody

General information about Ustekinumab

Ustekinumab is a human monoclonal antibody used to treat psoriasis. It is also approved to treat Crohn’s disease and ulcerative colitis among people who have not responded to more traditional treatments. It is a subcutaneous human interleukin 12 and interleukin 23 antagonist. These are naturally occurring proteins that regulate the immune system and immune-mediated inflammatory disorders. This product is for research use only.

SDS-PAGE for Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb

SDS-PAGE for Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

SEC-HPLC of Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Ustekinumab Biosimilar - Anti-Human IL-12 IL-23 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ustekinumab Biosimilar – Anti-Human IL-12 IL-23 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products