Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P29459&P29460
Molecular weight:
40kDa & 43kDa

Original price was: $370.00.Current price is: $308.00.

50ug 17% OFF + 308 loyalty points
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

Product name Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
Uniprot ID P29459&P29460
Uniprot link https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal Strep tag & C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession P29459&P29460
Spec:Entrez GeneID 3592 & 3593
Spec:NCBI Gene Aliases P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID Q96QZ1
NCBI Reference P29459&P29460
Aliases /Synonyms IL12AB
Reference PX-P4576
Note For research use only
Molecular Constructor
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His
Product name Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
Uniprot ID P29459&P29460
Uniprot link https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal Strep tag & C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession P29459&P29460
Spec:Entrez GeneID 3592 & 3593
Spec:NCBI Gene Aliases P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID Q96QZ1
NCBI Reference P29459&P29460
Aliases /Synonyms IL12AB
Reference PX-P4576
Note For research use only
Molecular Constructor
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His
Product name PX-P4576-1MG
Uniprot ID P29459&P29460
Uniprot link https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight 40kDa & 43kDa
Protein delivered with Tag? C-terminal Strep tag & C-terminal His Tag
Purity estimated >95% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession P29459&P29460
Spec:Entrez GeneID 3592 & 3593
Spec:NCBI Gene Aliases P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID Q96QZ1
NCBI Reference P29459&P29460
Aliases /Synonyms IL12AB
Reference PX-P4576
Note For research use only
Molecular Constructor
Met1–Ser219 Il12A & Il12B( Met1-Ser328 Strep His

Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)

There are no reviews yet.

Be the first to review “Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products