Name: Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &amp;( Met1-Ser328)
SKU: PX-P4576-10
Availability: InStock

Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Mammalian cells
Applications	Elisa, WB

Signal Transduction Virology

Product name	Interleukin-12 (IL12AB heterodimer) (Met1-Ser219) &( Met1-Ser328)
Uniprot ID	P29459&P29460
Uniprot link	https://www.uniprot.org/uniprot/P29459 & https://www.uniprot.org/uniprot/P29460
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS & MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Molecular weight	40kDa & 43kDa
Protein delivered with Tag?	C-terminal Strep tag & C-terminal His Tag
Purity estimated	>95% by SDS-PAGE
Buffer	PBS pH 7.5
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Il12A(Met1-Ser219) & Il12B( Met1-Ser328)
Protein Accession	P29459&P29460
Spec:Entrez GeneID	3592 & 3593
Spec:NCBI Gene Aliases	P35; CLMF; NFSK; NKSF1; IL-12A; NKSF; CLMF2; IMD28; IMD29; NKSF2; IL-12B
Spec:SwissProtID	Q96QZ1
NCBI Reference	P29459&P29460
Aliases /Synonyms	IL12AB
Reference	PX-P4576
Note	For research use only