Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

  • PX-P5667
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04141
Molecular weight:
17.26 kDa

$500.00

100ug + 500 loyalty points
Met1–Glu144 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

Product name CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein
Uniprot ID P04141
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Molecular weight 17.26 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Glu144
Protein Accession P04141
Reference PX-P5667
Note For research use only.
Molecular Constructor
Met1–Glu144 His

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein binds to Lenzilumab Biosimilar - Anti-CSF2 mAb in indirect ELISA assay

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein binds to Lenzilumab Biosimilar - Anti-CSF2 mAb in indirect ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Lenzilumab Biosimilar - Anti-CSF2 mAb (cat. No.PX-TA1360) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 33.07M.

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade (cat. No.PX-TA1141) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 152.1M.

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Namilumab Biosimilar - Anti-CSF2, GM-CSF mAb (cat. No.PX-TA1259) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 34.24M.

CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein

There are no reviews yet.

Be the first to review “CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products