Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade

  • PX-TA1141-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $217.00.Current price is: $167.00.

50ug 23% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

Product name Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1141-50
Uniprot ID P04141
Source CAS 1638332-55-4
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Otilimab,MOR-04357,3196165,GSK3196165,MOR103,CSF2, GM-CSF,anti-CSF2, GM-CSF
Reference PX-TA1141
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade: A Promising Therapeutic Antibody Targeting GM-CSF

Introduction

Otilimab Biosimilar, also known as Anti-CSF2 or GM-CSF mAb, is a monoclonal antibody (mAb) that specifically targets the cytokine granulocyte-macrophage colony-stimulating factor (GM-CSF). This biosimilar is a promising therapeutic agent with potential applications in various inflammatory and autoimmune diseases. In this article, we will delve into the structure, activity, and potential applications of Otilimab Biosimilar.

Structure of Otilimab Biosimilar

Otilimab Biosimilar is a recombinant humanized IgG1 monoclonal antibody that is derived from a mouse anti-human GM-CSF antibody. It consists of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 50 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) and one crystallizable fragment (Fc). The Fab region is responsible for binding to GM-CSF, while the Fc region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Otilimab Biosimilar

GM-CSF is a pro-inflammatory cytokine that plays a crucial role in the development and activation of immune cells, such as neutrophils, macrophages, and dendritic cells. It is also involved in the pathogenesis of various inflammatory and autoimmune diseases, including rheumatoid arthritis, multiple sclerosis, and psoriasis. Otilimab Biosimilar specifically binds to GM-CSF, preventing it from binding to its receptor and exerting its pro-inflammatory effects. This leads to a reduction in the activation and recruitment of immune cells, ultimately resulting in the suppression of inflammation.

Potential Applications of Otilimab Biosimilar

Otilimab Biosimilar has shown promising results in preclinical and clinical studies for the treatment of various inflammatory and autoimmune diseases. In a phase II clinical trial, Otilimab Biosimilar was found to be effective in reducing the signs and symptoms of rheumatoid arthritis, with a significant improvement in disease activity and joint damage. It has also shown potential for the treatment of other inflammatory conditions, such as psoriasis and asthma.

In addition to its potential as a therapeutic agent, Otilimab Biosimilar also has applications in research. Its ability to specifically target GM-CSF makes it a valuable tool for studying the role of this cytokine in different diseases. It can also be used to investigate the mechanisms of action of other GM-CSF targeting therapies and to identify potential biomarkers for response to treatment.

Advantages of Otilimab Biosimilar

One of the main advantages of Otilimab Biosimilar is its high specificity for GM-CSF, which minimizes the risk of off-target effects and reduces the potential for adverse reactions. Its humanized structure also reduces the risk of immunogenicity, making it a safe and well-tolerated treatment option. Additionally, as a biosimilar, Otilimab Biosimilar offers a more cost-effective alternative to the originator antibody, making it more accessible to patients.

Conclusion

In conclusion, Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade is a promising therapeutic antibody that specifically targets GM-CSF. Its structure, activity, and potential applications make it a valuable tool in the treatment and research of various inflammatory and autoimmune diseases. With ongoing clinical trials and further research, Otilimab Biosimilar has the potential to provide a more targeted and effective treatment option for patients in need.

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade binds to CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein in ELISA assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade (cat. No.PX-TA1141) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 152.1M.

Flow Cytometry results for Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Flow Cytometry results for Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Otilimab Biosimilar - Anti-CSF2;GM-CSF mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Otilimab Biosimilar - Anti-CSF2, GM-CSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Otilimab Biosimilar – Anti-CSF2, GM-CSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products