Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenzilumab Biosimilar – Anti-CSF2 mAb – Research Grade

  • PX-TA1360-50
  • Validated ELISA
Isotype:
IgG1, kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade

Product name Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade
Uniprot ID P04141
Source CAS 1229575-09-0
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Lenzilumab,KB-003,CSF2,anti-CSF2
Reference PX-TA1360
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade
Uniprot ID P04141
Source CAS 1229575-09-0
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Lenzilumab,KB-003,CSF2,anti-CSF2
Reference PX-TA1360
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1360-50
Uniprot ID P04141
Source CAS 1229575-09-0
Species Homo sapiens
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Lenzilumab,KB-003,CSF2,anti-CSF2
Reference PX-TA1360
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa

General information on Anti-CSF2[Homo sapiens] (Lenzilumab) Monoclonal Antibody

Lenzilumab is investigated for the treatment of Chronic Myelomonocytic Leukemia (CMML).

Lenzilumab Biosimilar - Anti-CSF2 mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Lenzilumab Biosimilar - Anti-CSF2 mAb binds to Human CSF2/GM-CSF in indirect ELISA Assay

Immobilized CSF2 / GM-CSF (in Mammalian), C-His, recombinant protein (cat. No.PX-P5667) at 0.5µg/mL (100µL/well) can bind Lenzilumab Biosimilar - Anti-CSF2 mAb (cat. No.PX-TA1360) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 33.07M.

SDS-PAGE for Lenzilumab Biosimilar - Anti-CSF2 mAb

SDS-PAGE for Lenzilumab Biosimilar - Anti-CSF2 mAb

Lenzilumab Biosimilar - Anti-CSF2 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Lenzilumab Biosimilar - Anti-CSF2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Lenzilumab Biosimilar – Anti-CSF2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products