Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Lenzilumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Lenzilumab ELISA Kit

Lenzilumab ELISA Kit

Product name Lenzilumab ELISA Kit
Uniprot ID P04141
Raw Antigen Sequence MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX140
Note For research use only.
Sample type Plasma, Serum
Target Lenzilumab
Immunogen Lenzilumab

The Structure of Lenzilumab ELISA Kit

Lenzilumab ELISA (enzyme-linked immunosorbent assay) Kit is a type of diagnostic tool used to detect and quantify the presence of Lenzilumab in biological samples. Lenzilumab is a humanized monoclonal antibody that specifically targets and binds to the soluble form of granulocyte-macrophage colony-stimulating factor (GM-CSF). The antibody is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL and CL1) and one variable domain (VL). The variable domains of the heavy and light chains form the antigen-binding site, also known as the Fab region, which is responsible for the specific recognition and binding of Lenzilumab to its target.

The Activity of Lenzilumab ELISA Kit

The activity of Lenzilumab ELISA Kit is based on the principle of enzyme-linked immunosorbent assay. This technique utilizes the specific binding of an antibody to its target antigen, followed by the detection of the bound antibody using an enzyme-linked secondary antibody. In the case of Lenzilumab ELISA Kit, the primary antibody is Lenzilumab, which binds to the GM-CSF antigen present in the sample. The secondary antibody is conjugated with an enzyme, such as horseradish peroxidase (HRP), which catalyzes a colorimetric reaction upon addition of a substrate. The intensity of the color produced is directly proportional to the amount of Lenzilumab present in the sample, making it a quantitative assay.

The Application of Lenzilumab ELISA Kit

Lenzilumab ELISA Kit has a wide range of applications in the field of medicine and research. It is primarily used for the detection and quantification of Lenzilumab in biological samples, such as serum, plasma, and cell culture supernatants. This makes it a valuable tool for monitoring the levels of Lenzilumab in patients undergoing treatment with this therapeutic antibody. In addition, Lenzilumab ELISA Kit can also be used to screen potential Lenzilumab candidates during drug development and to assess the pharmacokinetics of Lenzilumab in preclinical and clinical studies.

Moreover, Lenzilumab ELISA Kit can also be used for research purposes, such as studying the role of GM-CSF in various diseases and the efficacy of Lenzilumab in blocking its activity. GM-CSF is a cytokine that plays a critical role in the development and function of immune cells, and its dysregulation has been implicated in various autoimmune and inflammatory diseases, such as rheumatoid arthritis, multiple sclerosis, and asthma. Lenzilumab, as a specific inhibitor of GM-CSF, has shown promising results in clinical trials for the treatment of these diseases.

In conclusion, Lenzilumab ELISA Kit is a valuable tool for the detection and quantification of Lenzilumab in biological samples. Its high specificity and sensitivity make it an ideal choice for monitoring Lenzilumab levels in patients undergoing treatment and for research purposes. With the increasing interest in targeting GM-CSF as a therapeutic approach for various diseases, Lenzilumab ELISA Kit will continue to play a crucial role in the development and evaluation of this promising antibody.

Lenzilumab ELISA Kit

There are no reviews yet.

Be the first to review “Lenzilumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products