Brand: ProteoGenix

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

PX-P4032-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: O75144
Molecular weight:: 29.56kDa

$250.00

50ug + 250 loyalty points

Partial Yes

size size

50ug $250.00
100ug $500.00

Clear

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Product name	ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein
Uniprot ID	O75144
Uniprot link	http://www.uniprot.org/uniprot/O75144
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH
Molecular weight	29.56kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	ICOSL protein is stored: At 4°C for short term period (less than a week) At -20°C or -80°C for long term period Recommendations It is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1
Reference	PX-P4032
Note	For research use only
Molecular Constructor	Partial Yes

Product name	ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein
Uniprot ID	O75144
Uniprot link	http://www.uniprot.org/uniprot/O75144
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSGSHHHHHH
Molecular weight	29.56kDa
Protein delivered with Tag?	Yes
Purity estimated	90%
Buffer	50 mM Tris-HCl pH 8, 150 mM NaCl
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	ICOSL protein is stored: At 4°C for short term period (less than a week) At -20°C or -80°C for long term period Recommendations It is important to avoid avoid freezing/thawing cycles 20-40% glycerol may be added to improve cryoprotection
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Partial
Aliases /Synonyms	CD275, B7-H2, B7H2, B7RP-1, B7RP1, GL50, ICOS-L, ICOSL, LICOS, B7-like protein Gl50, B7-related protein 1
Reference	PX-P4032
Note	For research use only
Molecular Constructor	Partial Yes

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein, on SDS-PAGE under reducing

There are no reviews yet.

Be the first to review “ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein”

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL protein is stored:

Recommendations

ICOSL protein is stored:

Recommendations

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Related products

Garivulimab Biosimilar – Anti-CD274 mAb – Research Grade

Opucolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Sibeprenlimab Biosimilar – Anti-TNFSF13 mAb – Research Grade

Sudubrilimab Biosimilar – Anti-CD274 mAb – Research Grade

Sugemalimab Biosimilar – Anti-PDL1 mAb – Research Grade

Tarlatamab Biosimilar – Anti-DLL3;CD3E mAb – Research Grade

BMS-936559/MDX-1105 Biosimilar – Anti-B7-H1 mAb – Research Grade

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

TNFRSF10B recombinant protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Specifications ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

ICOSL protein is stored:

Recommendations

ICOSL protein is stored:

Recommendations

Documents

QC & Validation

SDS-PAGE for ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein

Reviews

Related products

Garivulimab Biosimilar – Anti-CD274 mAb – Research Grade

Opucolimab Biosimilar – Anti-PDL1 mAb – Research Grade

Sibeprenlimab Biosimilar – Anti-TNFSF13 mAb – Research Grade

Sudubrilimab Biosimilar – Anti-CD274 mAb – Research Grade

Sugemalimab Biosimilar – Anti-PDL1 mAb – Research Grade

Tarlatamab Biosimilar – Anti-DLL3;CD3E mAb – Research Grade

BMS-936559/MDX-1105 Biosimilar – Anti-B7-H1 mAb – Research Grade

Rozipafusp alfa Biosimilar – Anti-B7RP1 mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

TNFRSF10B recombinant protein

Recently viewed products

Can’t find what you need?

Cart (0 Items)

ICOSL Protein- Human ICOS ligand recombinant protein- CD278 Protein