Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P19438
Molecular weight:
22.66 kDa

Original price was: $252.00.Current price is: $230.00.

50ug 9% OFF + 230 loyalty points
Pro356–Leu441
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

Product name ARO-P10391-100
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441
Product name ARO-P10391-1MG
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441
Product name ARO-P10391-50
Uniprot ID P19438
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEAL
Molecular weight 22.66 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro356-Leu441
Aliases /Synonyms TNFR-I, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor superfamily member 1A, TBPI, p60, CD120a, TNFRSF1A, Tumor necrosis factor receptor type I, p55, TNF-RI, TNFAR, TNFR1, TNF-R1
Reference ARO-P10391
Note For research use only.
Molecular Constructor
Pro356–Leu441

Introduction

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, also known as Tumor Necrosis Factor Receptor 1 (TNFR1), is a type I transmembrane protein that belongs to the TNF receptor superfamily. It plays a crucial role in the regulation of immune response and inflammation. This protein is produced through recombinant technology and has been extensively studied for its structure, activity, and various applications in research and medicine.

Structure of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

The recombinant protein is a 55 kDa glycoprotein consisting of 455 amino acids. It has a single transmembrane domain and an extracellular domain that contains four cysteine-rich repeats. These cysteine-rich repeats are responsible for binding to its ligand, TNF-α. The cytoplasmic domain of the protein contains a death domain, which is crucial for initiating cell death signaling.

Activity of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

The main function of TNFR1 is to bind to its ligand, TNF-α, and initiate downstream signaling pathways. Upon binding, TNFR1 undergoes a conformational change and recruits adaptor proteins, such as TNF receptor-associated death domain (TRADD), TNF receptor-associated factor 2 (TRAF2), and receptor-interacting protein (RIP). This complex then activates various signaling pathways, including the NF-κB and MAPK pathways, leading to the production of cytokines and chemokines.

TNFR1 is also involved in regulating cell death through two distinct pathways: apoptosis and necroptosis. In the apoptotic pathway, TNFR1 activates caspase-8, which leads to cell death. In the necroptotic pathway, TNFR1 activates RIPK3 and MLKL, resulting in necrosis. The balance between these two pathways is crucial for maintaining tissue homeostasis and preventing excessive inflammation.

Applications of Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein has been extensively used in research and medicine for its various applications. Some of the key applications include:

1. Studying TNF-α signaling

As TNFR1 is the primary receptor for TNF-α, recombinant TNFR1 protein is used to study the signaling pathways activated by TNF-α. This has helped in understanding the role of TNF-α in various diseases, including autoimmune disorders and cancer.

2. Screening for potential drug targets

The TNF-α signaling pathway is a potential target for developing drugs to treat various diseases. Recombinant TNFR1 protein is used in screening assays to identify compounds that can modulate this pathway and potentially be developed into drugs.

3. Treating inflammatory diseases

TNFR1 is a key regulator of inflammation, and its dysregulation has been linked to various inflammatory diseases, such as rheumatoid arthritis and inflammatory bowel disease. Recombinant TNFR1 protein has been used in clinical trials for the treatment of these diseases, showing promising results.

4. Diagnosis of certain cancers

TNFR1 expression has been found to be elevated in certain types of cancers, such as breast and ovarian cancer. Recombinant TNFR1 protein has been used in diagnostic tests to detect

Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CD120a/TNFRSF1A/TNFR1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products