Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CEPT1 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6K0
Molecular weight:
19.53 kDa

Original price was: $347.00.Current price is: $274.00.

50ug 21% OFF + 274 loyalty points
Ser26–Asn86
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CEPT1 Protein, N-His-SUMO

Product name ARO-P10648-100
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86
Product name ARO-P10648-1MG
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86
Product name ARO-P10648-50
Uniprot ID Q9Y6K0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence STTGCVLNKLFQLPTPPLSRHQLKRLEEHRYQSAGRSLLEPLMQGYWEWLVRRVPSWIAPN
Molecular weight 19.53 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser26-Asn86
Aliases /Synonyms CEPT1, Choline/ethanolaminephosphotransferase 1, hCEPT1
Reference ARO-P10648
Note For research use only.
Molecular Constructor
Ser26–Asn86

Introduction

Recombinant Human CEPT1 Protein is a highly purified, bioactive protein that is produced through recombinant DNA technology. It is a member of the phospholipase D family and plays a crucial role in cellular lipid metabolism. In this article, we will discuss the structure, activity, and application of this protein.

Structure of Recombinant Human CEPT1 Protein

Recombinant Human CEPT1 Protein is a 120 kDa protein composed of 1057 amino acids. It contains a conserved catalytic domain and a conserved phospholipase D signature motif. The protein also has two transmembrane domains, which are essential for its function in lipid metabolism. It is expressed as a single polypeptide chain and undergoes post-translational modifications, including glycosylation and phosphorylation.

Activity of Recombinant Human CEPT1 Protein

Recombinant Human CEPT1 Protein is a key enzyme involved in the biosynthesis of phosphatidylcholine (PC), a major component of cell membranes. It catalyzes the hydrolysis of phosphatidylcholine to form phosphatidic acid and choline. This activity is essential for the maintenance of cellular membrane integrity and function.

In addition to its role in lipid metabolism, Recombinant Human CEPT1 Protein also has signaling functions. It has been shown to interact with various proteins, including small GTPases, and regulate their activity. This protein also plays a role in intracellular vesicle trafficking and membrane fusion processes.

Application of Recombinant Human CEPT1 Protein

Recombinant Human CEPT1 Protein has various applications in both research and clinical settings. Its role in lipid metabolism makes it a valuable tool for studying the mechanisms of lipid-related diseases, such as atherosclerosis. It is also used in drug discovery and development, as dysregulation of lipid metabolism is associated with various diseases, including cancer and metabolic disorders.

In the clinical setting, Recombinant Human CEPT1 Protein is used as an antigen in diagnostic assays for autoimmune diseases, such as systemic lupus erythematosus. It is also being investigated as a potential therapeutic target for various diseases, including cancer and neurological disorders.

Conclusion

In conclusion, Recombinant Human CEPT1 Protein is a crucial enzyme involved in cellular lipid metabolism. Its structure, activity, and various applications make it a valuable tool for both research and clinical purposes. Further studies on this protein may provide insights into the mechanisms of lipid-related diseases and lead to the development of novel treatments.

Recombinant Human CEPT1 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CEPT1 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products