Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P42830
Molecular weight:
18.62 kDa

Original price was: $332.00.Current price is: $265.00.

50ug 20% OFF + 265 loyalty points
Gly57–Asn114
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

Product name ARO-P11205-100
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114
Product name ARO-P11205-1MG
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114
Product name ARO-P11205-50
Uniprot ID P42830
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Molecular weight 18.62 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly57-Asn114
Aliases /Synonyms C-X-C motif chemokine 5, ENA-78(1-78), Neutrophil-activating peptide ENA-78, ENA78, SCYB5, Small-inducible cytokine B5, CXCL5, Epithelial-derived neutrophil-activating protein 78
Reference ARO-P11205
Note For research use only.
Molecular Constructor
Gly57–Asn114

Introduction

Recombinant proteins have become a vital tool in modern biomedical research and drug development. These proteins are produced through genetic engineering techniques, making it possible to produce large quantities of pure and highly specific proteins for various applications. One such protein is Recombinant Human CXCL5/ENA-78, which has gained significant attention in recent years due to its role in inflammation and immune response. In this article, we will delve into the structure, activity, and applications of this important protein.

Structure of Recombinant Human CXCL5/ENA-78 Protein

Recombinant Human CXCL5/ENA-78 is a member of the CXC chemokine family, which are small secreted proteins involved in immune response and inflammation. The protein is encoded by the CXCL5 gene and consists of 114 amino acids with a molecular weight of 12.5 kDa. It has a unique structure with a conserved N-terminal region and a variable C-terminal region. The N-terminal region contains four cysteine residues that form two disulfide bonds, while the C-terminal region is highly variable, giving rise to different isoforms of the protein.

Activity of Recombinant Human CXCL5/ENA-78 Protein

Recombinant Human CXCL5/ENA-78 protein plays a crucial role in recruiting and activating immune cells, particularly neutrophils, to sites of inflammation and infection. It does so by binding to its receptor, CXCR2, which is expressed on the surface of neutrophils. This interaction triggers a series of signaling events that lead to the migration of neutrophils to the site of inflammation. Additionally, Recombinant Human CXCL5/ENA-78 has been shown to have antimicrobial activity, further contributing to its role in immune defense.

Applications of Recombinant Human CXCL5/ENA-78 Protein

The unique structure and activity of Recombinant Human CXCL5/ENA-78 protein make it a valuable tool in various research and clinical applications. One of its primary uses is in the study of inflammation and immune response. By studying the interaction between the protein and its receptor, researchers can gain a better understanding of the underlying mechanisms of these processes. Additionally, Recombinant Human CXCL5/ENA-78 has been used in drug development, particularly in the development of anti-inflammatory and immunomodulatory drugs.

Furthermore, Recombinant Human CXCL5/ENA-78 has potential applications in the treatment of various diseases. Studies have shown that the protein is elevated in several inflammatory conditions, such as rheumatoid arthritis, inflammatory bowel disease, and asthma. By targeting the CXCL5/CXCR2 pathway, it may be possible to develop new therapies for these diseases. Additionally, the antimicrobial activity of Recombinant Human CXCL5/ENA-78 makes it a potential candidate for the treatment of infections caused by antibiotic-resistant bacteria.

Conclusion

In summary, Recombinant Human CXCL5/ENA-78 protein is a small but powerful molecule with a unique structure and diverse functions. Its role in inflammation and immune response has made it a valuable tool in research and drug development. As we continue to unravel the complexities of the human immune system, this protein holds great promise for the treatment of various diseases. With further research and development, Recombinant Human CXCL5/ENA-78 may pave the way for new and innovative therapies in the future.

Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO

There are no reviews yet.

Be the first to review “Recombinant Human CXCL5/ENA-78 Protein, N-His-SUMO”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products