Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human MAD1L1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9Y6D9
Molecular weight:
21.76 kDa

Original price was: $387.00.Current price is: $327.00.

100ug 16% OFF + 327 loyalty points
His544–Ala718
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human MAD1L1 Protein, N-His

Product name ARO-P11958-100
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718
Product name ARO-P11958-1MG
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718
Product name ARO-P11958-50
Uniprot ID Q9Y6D9
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence HMSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
Molecular weight 21.76 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His544-Ala718
Aliases /Synonyms HsMAD1, MAD1-like protein 1, hMAD1, Mitotic arrest deficient 1-like protein 1, Tax-binding protein 181, MAD1, TXBP181, Mitotic checkpoint MAD1 protein homolog, MAD1L1, Mitotic spindle assembly checkpoint protein MAD1
Reference ARO-P11958
Note For research use only.
Molecular Constructor
His544–Ala718

Introduction

Recombinant Human MAD1L1 Protein, also known as Mitotic Arrest Deficient 1-Like Protein 1, is a key regulatory protein involved in the cell cycle. It plays a crucial role in the maintenance of genomic stability and proper cell division. This protein is encoded by the MAD1L1 gene and has been extensively studied for its structure, activity, and potential applications in various fields of research.

Structure of Recombinant Human MAD1L1 Protein

The Recombinant Human MAD1L1 Protein is a 718 amino acid long protein with a molecular weight of 80 kDa. It is composed of three main domains – the N-terminal domain, the central domain, and the C-terminal domain. The N-terminal domain is responsible for binding to other proteins, while the central domain contains the conserved MAD1 domain, which is essential for the protein’s function. The C-terminal domain is involved in the regulation of the protein’s activity and its interaction with other proteins.

Activity of Recombinant Human MAD1L1 Protein

The primary function of Recombinant Human MAD1L1 Protein is to act as a mitotic checkpoint protein. It is involved in the spindle assembly checkpoint, which ensures proper chromosome alignment and segregation during cell division. This protein forms a complex with other checkpoint proteins, such as MAD2 and BUBR1, and is essential for the proper functioning of the checkpoint mechanism. It also plays a role in the DNA damage response and is involved in the repair of damaged DNA.

Additionally, Recombinant Human MAD1L1 Protein has been found to be overexpressed in various types of cancer, including breast, lung, and colon cancer. Its overexpression has been linked to chromosomal instability and tumorigenesis, making it a potential target for cancer therapy.

Applications of Recombinant Human MAD1L1 Protein

The Recombinant Human MAD1L1 Protein has various applications in the fields of research and medicine. It is widely used as an antigen in studies related to the cell cycle and mitotic checkpoint control. Its recombinant form is also used in biochemical and structural studies to understand the protein’s function and interactions with other proteins.

In cancer research, Recombinant Human MAD1L1 Protein has been used to study its role in tumorigenesis and as a potential target for cancer therapy. Its overexpression in cancer cells makes it a promising biomarker for early detection and diagnosis of certain types of cancer.

Furthermore, Recombinant Human MAD1L1 Protein has been used in the development of novel drugs targeting the mitotic checkpoint. Inhibitors of this protein have shown promising results in preclinical studies and are being explored as potential treatments for cancer and other diseases associated with cell cycle dysregulation.

Conclusion

In conclusion, Recombinant Human MAD1L1 Protein is a crucial protein involved in the regulation of the cell cycle and maintenance of genomic stability. Its structure and activity have been extensively studied, and it has various potential applications in the fields of research and medicine. Further research on this protein may lead to a better understanding of its role in disease and the development of effective treatments targeting the mitotic checkpoint.

Recombinant Human MAD1L1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human MAD1L1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products