Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human NSUN5 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q96P11
Molecular weight:
48.85 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Met1–Arg429
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human NSUN5 Protein, N-His

Product name ARO-P11810-100
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429
Product name ARO-P11810-1MG
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429
Product name ARO-P11810-50
Uniprot ID Q96P11
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MGLYAAAAGVLAGVESRQGSIKGLVYSSNFQNVKQLYALVCETQRYSAVLDAVIASAGLLRAEKKLRPHLAKVLVYELLLGKGFRGGGGRWKALLGRHQARLKAELARLKVHRGVSRNEDLLEVGSRPGPASQLPRFVRVNTLKTCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYILLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSTCSLCQEENEDVVRDALQQNPGAFRLAPALPAWPHRGLSTFPGAEHCLRASPETTLSSGFFVAVIERVEVPR
Molecular weight 48.85 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Arg429
Aliases /Synonyms NOL1R, NOL1-related protein, NSUN5, 28S rRNA (cytosine-C(5))-methyltransferase, WBSCR20A, NOL1/NOP2/Sun domain family member 5, WBSCR20, NSUN5A, Williams-Beuren syndrome chromosomal region 20A protein
Reference ARO-P11810
Note For research use only.
Molecular Constructor
Met1–Arg429

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins for research and therapeutic purposes. One such protein is Recombinant Human NSUN5 Protein, which has been extensively studied for its structure, activity, and potential applications.

Structure of Recombinant Human NSUN5 Protein

Recombinant Human NSUN5 Protein is a 41 kDa protein composed of 368 amino acids. It belongs to the NSUN family of proteins, which are characterized by their conserved S-adenosylmethionine (SAM)-dependent methyltransferase domain. This domain is responsible for the enzymatic activity of NSUN5, which involves the transfer of a methyl group from SAM to a target molecule.

The crystal structure of Recombinant Human NSUN5 Protein has been determined, revealing a unique fold with a central β-sheet surrounded by α-helices. This structure is important for the protein’s stability and function.

Activity of Recombinant Human NSUN5 Protein

The main activity of Recombinant Human NSUN5 Protein is its methyltransferase function. It specifically targets the 5-carbon of cytosine (C5) in RNA molecules and catalyzes the transfer of a methyl group, resulting in the formation of 5-methylcytosine (m5C). This modification plays a crucial role in regulating various cellular processes, including mRNA stability, translation, and splicing.

Studies have also shown that Recombinant Human NSUN5 Protein has a preference for particular RNA sequences, with a strong affinity for the sequence 5′-CAG-3′. This specificity allows for the precise targeting of specific RNA molecules for methylation.

Application of Recombinant Human NSUN5 Protein

Recombinant Human NSUN5 Protein has been studied for its potential applications in various fields, including cancer research, epigenetics, and neurodegenerative diseases.

One of the most promising applications of Recombinant Human NSUN5 Protein is in cancer research. Aberrant methylation patterns have been observed in many cancers, and NSUN5 has been found to play a role in these processes. Studies have shown that NSUN5 can act as a tumor suppressor by regulating the expression of certain genes involved in cancer progression. Additionally, NSUN5 has been identified as a potential biomarker for certain cancers, making it a valuable tool for diagnosis and prognosis.

In the field of epigenetics, Recombinant Human NSUN5 Protein has been found to play a role in the regulation of gene expression through RNA methylation. This has implications for understanding various diseases and potentially developing new therapies targeting epigenetic modifications.

Furthermore, Recombinant Human NSUN5 Protein has been linked to neurodegenerative diseases such as Alzheimer’s and Parkinson’s. Studies have shown that NSUN5 plays a role in the regulation of RNA metabolism in neurons, and dysregulation of this process has been linked to these diseases. This highlights the potential for NSUN5 as a therapeutic target for these devastating conditions.

Conclusion

In summary, Recombinant Human NSUN5 Protein is a 41 kDa protein with a unique structure and important enzymatic activity. Its ability to methylate specific RNA sequences has implications for various cellular processes and has been studied for its potential applications in cancer research, epigenetics, and neurodegenerative diseases. Further research on this protein may uncover even more potential uses and shed light on its role in various diseases.

Recombinant Human NSUN5 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human NSUN5 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products