Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human PAF1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q8N7H5
Molecular weight:
17.82 kDa

Original price was: $292.00.Current price is: $230.00.

50ug 21% OFF + 230 loyalty points
Met205–Arg336
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human PAF1 Protein, N-His

Product name ARO-P11992-100
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336
Product name ARO-P11992-1MG
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336
Product name ARO-P11992-50
Uniprot ID Q8N7H5
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MPVFPDFKMWINPCAQVIFDSDPAPKDTSGAAALEMMSQAMIRGMMDEEGNQFVAYFLPVEETLKKRKRDQEEEMDYAPDDVYDYKIAREYNWNVKNKASKGYEENYFFIFREGDGVYYNELETRVRLSKRR
Molecular weight 17.82 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met205-Arg336
Aliases /Synonyms PD2, RNA polymerase II-associated factor 1 homolog, Pancreatic differentiation protein 2, hPAF1, PAF1
Reference ARO-P11992
Note For research use only.
Molecular Constructor
Met205–Arg336

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins for various applications. One such recombinant protein is Recombinant Human PAF1 Protein, which has gained significant attention in the scientific community for its unique structure, activity, and potential applications.

Structure of Recombinant Human PAF1 Protein

Recombinant Human PAF1 Protein is a 91 kDa protein composed of 771 amino acids. It is a subunit of the RNA polymerase II associated factor 1 complex (PAF1C), which is involved in transcriptional regulation and elongation. The protein has a conserved domain structure, with an N-terminal domain, a central domain, and a C-terminal domain.

N-terminal domain

The N-terminal domain of Recombinant Human PAF1 Protein is responsible for its interaction with other subunits of the PAF1C complex, including CDC73, CTR9, and LEO1. This domain also plays a crucial role in the recruitment of the PAF1C complex to chromatin, where it regulates gene expression.

Central domain

The central domain of Recombinant Human PAF1 Protein contains a highly conserved region known as the PAF1 homology domain. This domain is essential for the interaction of PAF1C with RNA polymerase II, as well as for its role in transcriptional elongation and histone modifications.

C-terminal domain

The C-terminal domain of Recombinant Human PAF1 Protein is involved in the interaction with other transcriptional regulators, such as the Mediator complex. It also plays a role in the recruitment of PAF1C to actively transcribing genes and in the regulation of RNA processing and maturation.

Activity of Recombinant Human PAF1 Protein

Recombinant Human PAF1 Protein is a multifunctional protein with diverse activities in transcriptional regulation and elongation. It is involved in the recruitment and stabilization of the PAF1C complex to chromatin, where it interacts with various transcriptional regulators and histone-modifying enzymes to facilitate gene expression.

Transcriptional regulation

Recombinant Human PAF1 Protein plays a crucial role in transcriptional regulation by facilitating the recruitment and activation of RNA polymerase II at the promoter region of actively transcribed genes. It also interacts with other transcriptional regulators, such as the Mediator complex, to regulate gene expression.

Transcriptional elongation

One of the key functions of Recombinant Human PAF1 Protein is its role in transcriptional elongation. It interacts with RNA polymerase II and other elongation factors to promote efficient transcriptional elongation and processivity.

Histone modifications

Recombinant Human PAF1 Protein also plays a crucial role in histone modifications, which are essential for the regulation of gene expression. It interacts with various histone-modifying enzymes, such as histone methyltransferases and acetyltransferases, to regulate chromatin structure and gene expression.

Applications of Recombinant Human PAF1 Protein

The unique structure and multifunctional activity of Recombinant Human PAF1 Protein make it a valuable tool for various applications in the fields of molecular biology, biochemistry, and medicine.

Gene expression studies

Recombinant Human PAF1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human PAF1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products