Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human RBCK1 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BYM8
Molecular weight:
19.94 kDa

Original price was: $294.00.Current price is: $230.00.

50ug 22% OFF + 230 loyalty points
Met1–Gly156
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human RBCK1 Protein, N-His

Product name ARO-P12038-100
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156
Product name ARO-P12038-1MG
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156
Product name ARO-P12038-50
Uniprot ID Q9BYM8
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLG
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Gly156
Aliases /Synonyms RING finger protein 54, RNF54, RanBP-type and C3HC4-type zinc finger-containing protein 1, C20orf18, XAP4, Hepatitis B virus X-associated protein 4, UBCE7IP3, RBCK1, RING-type E3 ubiquitin transferase HOIL-1, HOIL-1, Heme-oxidized IRP2 ubiquitin ligase 1, XAP3, Ubiquitin-conjugating enzyme 7-interacting protein 3, HBV-associated factor 4
Reference ARO-P12038
Note For research use only.
Molecular Constructor
Met1–Gly156

Introduction

Recombinant proteins are proteins that are produced through genetic engineering techniques, allowing for the production of large quantities of specific proteins for various applications. One such recombinant protein is Recombinant Human RBCK1 Protein, a crucial component of the ubiquitination pathway. In this article, we will explore the structure, activity, and application of this protein.

Structure of Recombinant Human RBCK1 Protein

The gene encoding for RBCK1 protein is located on chromosome 20 and is composed of 15 exons. The protein itself is composed of 518 amino acids with a molecular weight of approximately 58 kDa. It contains several functional domains, including a zinc finger domain, a coiled-coil domain, and a RING finger domain, which is essential for its E3 ubiquitin ligase activity.

Activity of Recombinant Human RBCK1 Protein

RBCK1 protein plays a crucial role in the ubiquitination pathway, which is responsible for targeting proteins for degradation. It acts as an E3 ubiquitin ligase, which means it facilitates the transfer of ubiquitin molecules to target proteins. This process is essential for regulating various cellular processes, such as protein turnover, DNA repair, and cell signaling.

RBCK1 protein has been shown to interact with several proteins involved in the ubiquitination pathway, including E2 enzymes and other E3 ligases. It has also been found to play a role in the degradation of misfolded proteins and the regulation of cell cycle progression.

Application of Recombinant Human RBCK1 Protein

Recombinant Human RBCK1 Protein has various applications in both research and therapeutic settings. Its role in the ubiquitination pathway makes it a valuable tool for studying protein degradation and cellular processes. It can also be used to investigate the function of RBCK1 in various diseases, such as cancer and neurodegenerative disorders.

In therapeutic applications, RBCK1 protein has been shown to have potential as a target for cancer treatment. Studies have found that inhibiting RBCK1 activity can lead to decreased cell growth and increased cell death in cancer cells. Additionally, RBCK1 has been implicated in the development of Parkinson’s disease, making it a potential target for therapeutic intervention.

Conclusion

In summary, Recombinant Human RBCK1 Protein is a crucial component of the ubiquitination pathway with a diverse range of functions. Its structure, activity, and application make it a valuable tool for both research and therapeutic purposes. Further studies on RBCK1 and its interactions may lead to a better understanding of its role in various diseases and the development of new treatments.

Recombinant Human RBCK1 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human RBCK1 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products