Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human SLC25A37 Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9NYZ2
Molecular weight:
32.93 kDa

Original price was: $374.00.Current price is: $327.00.

100ug 13% OFF + 327 loyalty points
Pro65–Arg105
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human SLC25A37 Protein, N-GST & C-His

Product name ARO-P11347-100
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105
Product name ARO-P11347-1MG
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105
Product name ARO-P11347-50
Uniprot ID Q9NYZ2
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence PVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLR
Molecular weight 32.93 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Pro65-Arg105
Aliases /Synonyms SLC25A37, Solute carrier family 25 member 37, Mitochondrial iron transporter 1, MSCP, Mitochondrial solute carrier protein, MFRN, Mitoferrin-1
Reference ARO-P11347
Note For research use only.
Molecular Constructor
Pro65–Arg105

Introduction to Recombinant Human SLC25A37 Protein

Recombinant human SLC25A37 protein, also known as the solute carrier family 25 member 37, is a mitochondrial protein that plays a crucial role in cellular metabolism and energy production. This protein is encoded by the SLC25A37 gene and is highly conserved among various species, indicating its importance in biological processes.

Structure of Recombinant Human SLC25A37 Protein

The recombinant human SLC25A37 protein is composed of 304 amino acids with a molecular weight of approximately 33 kDa. It belongs to the mitochondrial carrier family, which is responsible for transporting metabolites, cofactors, and other small molecules across the inner mitochondrial membrane. The structure of this protein consists of six transmembrane domains, with the N- and C-termini facing the cytoplasm. It also contains two signature motifs, the P-loop and the mitochondrial carrier signature, which are essential for its transport function.

Activity of Recombinant Human SLC25A37 Protein

The main function of recombinant human SLC25A37 protein is to transport coenzyme A (CoA) into the mitochondrial matrix, where it is involved in various metabolic pathways, including the tricarboxylic acid (TCA) cycle, fatty acid oxidation, and amino acid metabolism. CoA is an essential cofactor that plays a crucial role in energy production by transferring acyl groups between different metabolic pathways. The transport of CoA by SLC25A37 is necessary for maintaining the balance of these metabolic processes and ensuring efficient energy production.

In addition to its role in CoA transport, recombinant human SLC25A37 protein has been shown to interact with other proteins involved in mitochondrial metabolism, such as the adenine nucleotide translocase (ANT) and the uncoupling proteins (UCPs). These interactions suggest that SLC25A37 may play a role in regulating mitochondrial respiration and energy expenditure.

Application of Recombinant Human SLC25A37 Protein

The recombinant human SLC25A37 protein has various applications in both research and clinical settings. One of its primary uses is in studying the role of mitochondrial metabolism in diseases. Mutations in the SLC25A37 gene have been linked to various disorders, including mitochondrial encephalomyopathy, lactic acidosis, and stroke-like episodes (MELAS), and Leigh syndrome. Recombinant human SLC25A37 protein can be used to investigate the effects of these mutations on its structure and function, providing insights into the underlying mechanisms of these diseases.

Furthermore, recombinant human SLC25A37 protein has potential therapeutic applications. As it is involved in energy production and metabolism, targeting SLC25A37 could be a promising strategy for treating metabolic disorders. For instance, modulating the activity of SLC25A37 could help restore CoA levels in patients with CoA deficiency disorders, leading to improved energy production and metabolism. Additionally, targeting SLC25A37 could also be beneficial in the treatment of obesity and diabetes, as it may regulate energy expenditure through its interactions with UCPs.

Conclusion

In summary, recombinant human SLC25A37 protein is a crucial mitochondrial protein involved in CoA transport and metabolism. Its structure and function make it an essential player in cellular energy production and metabolic homeostasis. Its diverse applications in research and potential therapeutic uses make it a promising target for further studies. Understanding the structure, activity, and application of recombinant human SLC25A37 protein is crucial in advancing our knowledge of mitochondrial metabolism and its implications in health and disease.

Recombinant Human SLC25A37 Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Human SLC25A37 Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products