Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TCL1A, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P56279
Molecular weight:
15.77 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
His Met1–Asp114
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TCL1A, N-His

Product name ARO-P13609-100
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114
Product name ARO-P13609-1MG
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114
Product name ARO-P13609-50
Uniprot ID P56279
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
Molecular weight 15.77 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asp114
Aliases /Synonyms Oncogene TCL1, Oncogene TCL-1, Protein p14 TCL1, TCL1A, T-cell leukemia/lymphoma protein 1A, TCL1
Reference ARO-P13609
Note For research use only.
Molecular Constructor
His Met1–Asp114

Introduction to Recombinant Human TCL1A

Recombinant Human TCL1A, also known as T-cell leukemia/lymphoma protein 1A, is a protein that plays a crucial role in the development and function of T-cells. It is a member of the TCL1 family of proteins, which are known to be involved in various cellular processes such as cell cycle regulation, apoptosis, and signal transduction. Recombinant Human TCL1A is a genetically engineered version of the native human protein, produced through recombinant DNA technology. This allows for large-scale production of the protein, making it a valuable tool for research and potential therapeutic applications.

Structure of Recombinant Human TCL1A

The native human TCL1A protein is composed of 123 amino acids, with a molecular weight of approximately 14 kDa. Recombinant Human TCL1A is produced in a similar manner, with the protein sequence being inserted into a suitable expression vector and then expressed in a host cell, typically E. coli or yeast. The resulting protein is then purified and can be used for various applications.

The crystal structure of Recombinant Human TCL1A has been determined, revealing that it forms a homodimer in its active form. Each monomer consists of a five-stranded beta-sheet surrounded by alpha-helices, with a conserved hydrophobic pocket that is essential for its function. This structure is important for protein-protein interactions and allows for the binding of other proteins involved in T-cell signaling pathways.

Activity of Recombinant Human TCL1A

The main function of Recombinant Human TCL1A is to regulate the development and function of T-cells. It has been shown to be essential for the survival of T-cells and is involved in the proliferation and differentiation of these cells. It also plays a role in the activation of T-cell receptor signaling pathways, which are crucial for the immune response.

Recombinant Human TCL1A has also been found to have oncogenic properties, as it is overexpressed in various types of T-cell lymphomas. It has been shown to promote cell growth and inhibit apoptosis, leading to the uncontrolled proliferation of cancer cells. Therefore, understanding the activity of this protein is crucial for developing potential therapeutic interventions for T-cell lymphomas.

Applications of Recombinant Human TCL1A

Recombinant Human TCL1A has a wide range of applications in both research and potential therapeutic fields. Some of the key applications include:

  • Studying T-cell development and function: Recombinant Human TCL1A can be used to study the role of this protein in T-cell development and function. It can be added to cell cultures to observe its effects on T-cell proliferation, differentiation, and survival.
  • Drug discovery: As Recombinant Human TCL1A is involved in T-cell signaling pathways, it can be a potential target for drug discovery in diseases such as T-cell lymphomas. Recombinant Human TCL1A can be used in screening assays to identify compounds that can modulate its activity.
  • Therapeutic applications: Recombinant Human TCL1A has shown potential as a therapeutic target for T-cell lymphomas. By understanding its structure and activity, researchers can develop targeted therapies that can inhibit its oncogenic properties and potentially treat these types of cancers.

Conclusion

In summary, Recombinant Human TCL1A is a crucial protein involved in T-cell development and function. Its structure, activity, and potential applications make it a valuable tool for research and potential therapeutic interventions. Further studies on this protein can lead to a better understanding of T-cell biology and the development of novel treatments for diseases associated with T-cell dysfunction.

Recombinant Human TCL1A, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TCL1A, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products