Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Human TMED9 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q9BVK6
Molecular weight:
14.79 kDa

Original price was: $262.00.Current price is: $230.00.

50ug 12% OFF + 230 loyalty points
Leu38–Gly146
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Human TMED9 Protein, N-His

Product name ARO-P10687-100
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146
Product name ARO-P10687-1MG
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146
Product name ARO-P10687-50
Uniprot ID Q9BVK6
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence LYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVG
Molecular weight 14.79 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Leu38-Gly146
Aliases /Synonyms Glycoprotein 25L2, GP25L2, p24alpha2, GMP25, p24 family protein alpha-2, p25, Transmembrane emp24 domain-containing protein 9, TMED9
Reference ARO-P10687
Note For research use only.
Molecular Constructor
Leu38–Gly146

Introduction

Recombinant proteins, also known as recombinant antigens, are proteins that are produced through genetic engineering techniques. These proteins have become an essential tool in various fields of research, including biotechnology, medicine, and diagnostics. One such recombinant protein is the human TMED9 protein, which has gained significant attention due to its unique structure and diverse functions.

Structure of Recombinant Human TMED9 Protein

The human TMED9 protein, also known as Transmembrane Emp24 Domain-Containing Protein 9, is a member of the TMED family of proteins. It is a type I transmembrane protein with a molecular weight of approximately 24 kDa. The protein is composed of 211 amino acids and contains a conserved transmembrane domain at its C-terminus, which anchors the protein to the cell membrane. The N-terminus of TMED9 contains a coiled-coil domain, which is involved in protein-protein interactions.

Activity of Recombinant Human TMED9 Protein

The primary function of TMED9 is to act as a cargo receptor in the early secretory pathway. It is involved in the transport of newly synthesized proteins from the endoplasmic reticulum (ER) to the Golgi apparatus. TMED9 interacts with various other proteins, including the COPII coat complex, to facilitate the transport of cargo proteins. Additionally, TMED9 has been found to play a role in the maintenance of ER homeostasis and the regulation of ER stress response.

Application of Recombinant Human TMED9 Protein

Recombinant human TMED9 protein has numerous applications in both research and clinical settings. One of the primary uses of this protein is in the production of antibodies for diagnostic purposes. The unique structure of TMED9 makes it an ideal antigen for antibody production, as it can elicit a strong immune response in animals. These antibodies can then be used in various diagnostic assays, such as ELISA and Western blot, to detect the presence of TMED9 in biological samples.

Moreover, recombinant TMED9 protein has been used in studies to understand its role in protein trafficking and ER stress response. By overexpressing or silencing TMED9 in cells, researchers can investigate its impact on these processes and gain insights into its function. This information can be crucial in developing therapies for diseases related to protein trafficking and ER stress, such as cystic fibrosis and Alzheimer’s disease.

Another potential application of recombinant TMED9 protein is in the development of targeted drug delivery systems. As TMED9 is involved in the transport of cargo proteins, it can be utilized to deliver therapeutic molecules to specific cells or tissues. This approach can improve the efficacy and reduce the side effects of drugs.

Conclusion

In conclusion, recombinant human TMED9 protein is a versatile tool with a unique structure and diverse functions. Its role in protein trafficking and ER stress response makes it a valuable target for research and potential therapeutic applications. With ongoing studies and advancements in genetic engineering techniques, the use of recombinant TMED9 protein is expected to increase in the future.

Recombinant Human TMED9 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Human TMED9 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products