Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q2TB54
Molecular weight:
40.54 kDa

Original price was: $343.00.Current price is: $274.00.

50ug 20% OFF + 274 loyalty points
Thr81–Ser191
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

Product name ARO-P10554-100
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191
Product name ARO-P10554-1MG
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191
Product name ARO-P10554-50
Uniprot ID Q2TB54
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence TNALRGPRLVTGNTGGAVTIHCHYAPSSVNRHQRKYWCRLGSPLWICHTVVSTNQYTHPDYRGRAALTDIPQSGLFVVRLLRLSLGDVGLYRCGIGDRNDMLFFSVNLTVS
Molecular weight 40.54 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Thr81-Ser191
Aliases /Synonyms FCAMR, High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor, CD351, Fc alpha/mu receptor
Reference ARO-P10554
Note For research use only.
Molecular Constructor
Thr81–Ser191

Introduction to Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein, also known as Fc receptor-like A (FCAR), is a type I transmembrane protein that belongs to the Fc receptor family. It is encoded by the FCAR gene and is primarily expressed on the surface of immune cells, such as macrophages, dendritic cells, and B cells. This protein plays a crucial role in the regulation of immune responses and has been extensively studied for its potential therapeutic applications.

Structure of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein is a 55 kDa glycoprotein that consists of a single extracellular domain, a transmembrane domain, and a cytoplasmic tail. The extracellular domain contains two immunoglobulin-like domains, IgV and IgC2, which are responsible for binding to immunoglobulin G (IgG) and other Fc-containing molecules. The transmembrane domain anchors the protein to the cell membrane, while the cytoplasmic tail contains signaling motifs that regulate the activity of the protein.

Activity of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein acts as a receptor for IgG and other Fc-containing molecules, such as immune complexes and opsonized particles. Upon binding, it initiates a signaling cascade that leads to the activation of immune cells and the release of pro-inflammatory cytokines. This activity is crucial for the clearance of pathogens and the initiation of an effective immune response.

In addition to its role as an Fc receptor, Recombinant Mouse CD351/FCAMR Protein also functions as a co-stimulatory molecule for T cells. It interacts with the T cell receptor and enhances T cell activation, proliferation, and cytokine production. This activity is essential for the development of adaptive immune responses and the control of chronic infections.

Application of Recombinant Mouse CD351/FCAMR Protein

Recombinant Mouse CD351/FCAMR Protein has been extensively studied for its potential therapeutic applications. One of the most promising uses of this protein is in the treatment of autoimmune diseases. By modulating the activity of immune cells, Recombinant Mouse CD351/FCAMR Protein can potentially suppress the overactive immune response that is characteristic of autoimmune disorders. This has been demonstrated in preclinical studies using animal models of multiple sclerosis, rheumatoid arthritis, and lupus.

Another potential application of Recombinant Mouse CD351/FCAMR Protein is in cancer immunotherapy. By activating immune cells and promoting the release of pro-inflammatory cytokines, this protein can enhance the anti-tumor immune response and aid in the elimination of cancer cells. In fact, a recent study showed that targeting Recombinant Mouse CD351/FCAMR Protein in combination with other immunotherapies resulted in improved tumor control and increased survival in a mouse model of melanoma.

Furthermore, Recombinant Mouse CD351/FCAMR Protein has also been investigated for its role in infectious diseases. By enhancing the activity of immune cells, this protein can potentially aid in the clearance of pathogens and improve the efficacy of vaccines. In a study on influenza virus infection, it was found that Recombinant Mouse CD351/FCAMR Protein can enhance the production of virus-specific antibodies and improve the survival of infected mice.

In summary, Recombinant Mouse CD351/FCAMR Protein is a versatile protein with important roles in immune regulation, T cell co-stimulation, and potential therapeutic applications. Its ability to modulate immune responses makes it a promising target for the treatment of autoimmune diseases, cancer, and infectious diseases. Further research and clinical trials are needed to fully understand the potential of this protein and its application in various diseases.

Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD351/FCAMR Protein, N-GST & C-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products