Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse CD68 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P31996
Molecular weight:
20.57 kDa

Original price was: $257.00.Current price is: $230.00.

50ug 11% OFF + 230 loyalty points
Gly125–Ser291
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse CD68 Protein, N-His

Product name ARO-P10588-100
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291
Product name ARO-P10588-1MG
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291
Product name ARO-P10588-50
Uniprot ID P31996
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence GALGNYTWANGSQPCVQLQAQIQIRILYPIQGGRKAWGISVLNPNKTKVQGGCDGTHPHLSLSFPYGQLTFGFKQDLHQSPSTVYLDYMAVEYNVSFPQAAQWTFMAQNSSLRELQAPLGQSFCCGNASIVLSPAVHLDLLSLRLQAAQLPDKGHFGPCFSCNRDQS
Molecular weight 20.57 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly125-Ser291
Aliases /Synonyms CD68, Gp110, Macrosialin
Reference ARO-P10588
Note For research use only.
Molecular Constructor
Gly125–Ser291

Introduction

Recombinant mouse CD68 protein is a highly purified, bioactive protein that plays a crucial role in the immune system. It is a member of the lysosomal-associated membrane protein (LAMP) family and is primarily expressed on the surface of macrophages and monocytes. This protein is involved in various cellular processes, including antigen presentation, phagocytosis, and cytokine production. In this article, we will discuss the structure, activity, and applications of recombinant mouse CD68 protein.

Structure of Recombinant Mouse CD68 Protein

The recombinant mouse CD68 protein is a 37-40 kDa transmembrane glycoprotein consisting of 354 amino acids. It has a short cytoplasmic tail, a single transmembrane domain, and a large extracellular domain. The extracellular domain of CD68 contains multiple glycosylation sites, which are important for its stability and function. The protein also has a conserved cysteine-rich domain, which is involved in protein-protein interactions and is essential for its biological activity.

Activity of Recombinant Mouse CD68 Protein

Recombinant mouse CD68 protein is a key player in the immune response, particularly in the innate immune system. It is primarily expressed on the surface of macrophages and monocytes, where it acts as a scavenger receptor, binding to and internalizing a variety of ligands, including modified lipoproteins, bacteria, and apoptotic cells. This process, known as phagocytosis, is essential for the clearance of foreign particles and debris from the body.

Apart from its role in phagocytosis, recombinant mouse CD68 protein also plays a crucial role in antigen presentation. It is involved in the processing and presentation of antigens to T cells, which are essential for the activation of the adaptive immune response. CD68 acts as a co-stimulatory molecule, enhancing the activation and proliferation of T cells, and also regulates the production of cytokines, such as interleukin-1 and tumor necrosis factor-alpha.

Applications of Recombinant Mouse CD68 Protein

Recombinant mouse CD68 protein has a wide range of applications in both research and clinical settings. Its ability to bind and internalize a variety of ligands makes it a valuable tool for studying phagocytosis and the innate immune response. It is also commonly used as a marker for macrophages and monocytes in various cell isolation and characterization techniques.

In addition, recombinant mouse CD68 protein has been used in cancer research, as it is overexpressed in certain types of tumors, including breast, ovarian, and prostate cancer. It has also been implicated in the progression and metastasis of these cancers, making it a potential therapeutic target.

Furthermore, recombinant mouse CD68 protein has been used in the development of vaccines and immunotherapies. Its role in antigen presentation and T cell activation makes it a promising candidate for enhancing immune responses against various diseases, including infectious diseases and cancer.

Conclusion

In summary, recombinant mouse CD68 protein is a key player in the immune system, with multiple functions in phagocytosis, antigen presentation, and cytokine production. Its structure, consisting of a transmembrane domain and large extracellular domain with multiple glycosylation sites, is essential for its activity. This protein has a wide range of applications in research and clinical settings, making it a valuable tool for studying the immune response and developing therapies for various diseases.

Recombinant Mouse CD68 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse CD68 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products