Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Recombinant Mouse FGL2 Protein, N-His

Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
P12804
Molecular weight:
29.55 kDa

Original price was: $289.00.Current price is: $230.00.

50ug 20% OFF + 230 loyalty points
His200–Pro432
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Recombinant Mouse FGL2 Protein, N-His

Product name ARO-P11120-100
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432
Product name ARO-P11120-1MG
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432
Product name ARO-P11120-50
Uniprot ID P12804
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence HLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
Molecular weight 29.55 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type His200-Pro432
Aliases /Synonyms Fiblp, Cytotoxic T-lymphocyte-specific protein, Fibrinogen-like protein 2, Fibroleukin, Prothrombinase, Fgl2
Reference ARO-P11120
Note For research use only.
Molecular Constructor
His200–Pro432

Introduction

Recombinant Mouse FGL2 Protein, also known as Fibrinogen-like protein 2, is a highly versatile protein that plays a crucial role in various physiological processes. This protein is encoded by the FGL2 gene and is a member of the fibrinogen-like protein family. It is predominantly expressed in the liver, but can also be found in other tissues such as the spleen, lung, and kidney.

Structure of Recombinant Mouse FGL2 Protein

The recombinant form of FGL2 protein is produced by cloning and expressing the FGL2 gene in a suitable host cell. The resulting protein is a 50 kDa glycoprotein that consists of 453 amino acids. It contains a signal peptide at the N-terminus, followed by a fibrinogen-like domain, a thrombospondin type-1 repeat (TSR), and a C-terminal lectin-like domain. The fibrinogen-like domain is responsible for binding to fibrinogen and other proteins, while the TSR and lectin-like domain play a role in protein-protein interactions and immune regulation, respectively.

Activity of Recombinant Mouse FGL2 Protein

Recombinant Mouse FGL2 Protein has been shown to have multiple activities in various biological processes. One of its main functions is its ability to bind to fibrinogen, which is essential for blood clotting. This protein also has anti-thrombotic properties by inhibiting the activity of thrombin, a key enzyme involved in blood coagulation. In addition, FGL2 has been found to have immunomodulatory effects by regulating the activity of immune cells, such as T cells and natural killer cells. It can also induce apoptosis in certain types of cancer cells, making it a potential therapeutic agent for cancer treatment.

Application of Recombinant Mouse FGL2 Protein

The diverse activities of Recombinant Mouse FGL2 Protein make it a valuable tool in various research areas. One of its main applications is in the study of blood coagulation and thrombosis, as it is involved in the formation and dissolution of blood clots. This protein has also been studied in the context of autoimmune diseases, as it has been found to play a role in regulating the immune response. Recombinant Mouse FGL2 Protein has also been investigated for its potential use in cancer therapy, as its ability to induce apoptosis in cancer cells has shown promising results in pre-clinical studies.

Conclusion

In summary, Recombinant Mouse FGL2 Protein is a multifunctional protein that plays a crucial role in various physiological processes. Its structure, activity, and applications make it a valuable tool for research in areas such as blood coagulation, immune regulation, and cancer therapy. Further studies on this protein may lead to a better understanding of its functions and potential therapeutic uses.

Keywords

Recombinant protein, antigen, FGL2, fibrinogen-like protein, thrombosis, immune regulation, cancer therapy.

Recombinant Mouse FGL2 Protein, N-His

There are no reviews yet.

Be the first to review “Recombinant Mouse FGL2 Protein, N-His”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products