Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade

  • PX-TA1460-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

Product name Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1460-50
Uniprot ID P09616
Source CAS 1629620-18-3
Species Homo sapiens
Raw Antigen Sequence MKTRIVSSVTTTLLLGSILMNPVAGAADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWTDRSSERYKIDWEKEEMTN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Suvratoxumab,MEDI4893,alpha toxin,anti-alpha toxin
Reference PX-TA1460
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Suvratoxumab Biosimilar: A Potent Anti-Alpha Toxin Antibody for Therapeutic Targeting

Suvratoxumab Biosimilar is a novel monoclonal antibody (mAb) that specifically targets the alpha toxin produced by

Staphylococcus aureus

, a Gram-positive bacterium responsible for a wide range of infections in humans. This biosimilar is a highly potent and specific therapeutic agent that has shown promising results in preclinical studies, making it a potential candidate for the treatment of various staphylococcal infections.

Structure of Suvratoxumab Biosimilar

Suvratoxumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody, which means it is derived from human antibodies and has been engineered to have a longer half-life in the body. It is composed of two heavy chains and two light chains, each with a variable region that specifically binds to the alpha toxin. The constant region of the antibody is responsible for activating the immune system to eliminate the toxin.

The structure of Suvratoxumab Biosimilar is similar to that of the original antibody, suvratoxumab, which was developed by GlaxoSmithKline. However, the biosimilar has been modified to have a higher binding affinity and potency against the alpha toxin, making it a more effective therapeutic agent.

Activity of Suvratoxumab Biosimilar

The main activity of Suvratoxumab Biosimilar is to neutralize the alpha toxin produced by

S. aureus

. This toxin is a major virulence factor of the bacterium and is responsible for causing tissue damage and cell death, leading to the development of various infections. By binding to the toxin, the biosimilar prevents it from interacting with its target cells and causing harm.

Suvratoxumab Biosimilar also has an immunomodulatory activity, which means it can modulate the immune response to the toxin. This is achieved through the antibody’s constant region, which activates the immune cells to eliminate the toxin and infected cells.

Application of Suvratoxumab Biosimilar

Suvratoxumab Biosimilar has shown great potential as a therapeutic agent for the treatment of staphylococcal infections. In preclinical studies, it has demonstrated efficacy against a wide range of

S. aureus

strains, including those resistant to conventional antibiotics. This makes it a promising alternative for the treatment of antibiotic-resistant infections, which are becoming a major global health concern.

The biosimilar is currently in the early stages of clinical development, with a Phase 1 study evaluating its safety and tolerability in healthy volunteers. If successful, it will progress to Phase 2 and 3 trials to assess its efficacy in patients with staphylococcal infections.

Besides its potential as a therapeutic agent, Suvratoxumab Biosimilar can also be used as a research tool for studying the role of the alpha toxin in staphylococcal infections. The biosimilar can be used to block the toxin’s activity in laboratory experiments, providing valuable insights into its mechanism of action and potential therapeutic targets.

Conclusion

Suvratoxumab Biosimilar is a highly specific and potent anti-alpha toxin antibody with promising potential as a therapeutic agent for the treatment of staphylococcal infections. Its unique structure and activity make it a valuable addition to the arsenal of treatments against antibiotic-resistant infections. With ongoing clinical development, this biosimilar has the potential to improve outcomes for patients with staphylococcal infections and contribute to the fight against antibiotic resistance.

Keywords: Suvratoxumab Biosimilar, anti-alpha toxin, monoclonal antibody, therapeutic target, S. aureus

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade in ELISA Assay

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade in ELISA Assay

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade

SDS-PAGE for Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade

Suvratoxumab Biosimilar - Anti-Alpha-toxin;hly mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Suvratoxumab Biosimilar - Anti-alpha toxin mAb - Research Grade

There are no reviews yet.

Be the first to review “Suvratoxumab Biosimilar – Anti-alpha toxin mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products