Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Taldefgrobep alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade

Uniprot ID:
O14793

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Product name Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2
Product name Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2
Product name PX-TA2038-50
Uniprot ID O14793
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-GDF-8, GDF8, MSTN, Myostatin, Growth/differentiation factor 8
Reference PX-TA2038
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - IGHG1 Fc (Fragment constant) - [peptidyl linker - Alternative to antigen receptors (domain scaffold: FN1 F10, fibronectin domain F10)]2

The Structure of Taldefgrobep alfa Biosimilar – Anti-GDF-8 Fusion Protein

Taldefgrobep alfa Biosimilar is a fusion protein that is designed to target the growth differentiation factor 8 (GDF-8), also known as myostatin. It is a biosimilar of the FDA-approved drug, Bimagrumab, which is used to treat muscle wasting disorders such as muscular dystrophy and sarcopenia.

The structure of Taldefgrobep alfa Biosimilar is composed of two parts: the antibody and the GDF-8 targeting domain. The antibody portion is derived from a humanized monoclonal antibody, which is a type of protein that is engineered to bind specifically to a target molecule. In this case, the antibody is designed to bind to GDF-8 with high affinity.

The GDF-8 targeting domain is a fusion of two proteins: the extracellular domain of the activin type IIB receptor (ActRIIB) and the Fc region of human immunoglobulin G1 (IgG1). The ActRIIB domain is responsible for binding to GDF-8, while the Fc region is important for increasing the half-life and stability of the fusion protein.

The Activity of Taldefgrobep alfa Biosimilar

Taldefgrobep alfa Biosimilar works by blocking the activity of GDF-8, a protein that is known to inhibit muscle growth and promote muscle wasting. GDF-8 is a member of the transforming growth factor-β (TGF-β) superfamily and is primarily produced by skeletal muscle cells.

When GDF-8 binds to its receptor, ActRIIB, it activates a signaling pathway that leads to the inhibition of muscle growth. By binding to GDF-8, Taldefgrobep alfa Biosimilar prevents this signaling pathway from being activated, thereby promoting muscle growth and preventing muscle wasting.

The Application of Taldefgrobep alfa Biosimilar

Taldefgrobep alfa Biosimilar is primarily being developed as a potential treatment for muscle wasting disorders such as muscular dystrophy and sarcopenia. These conditions are characterized by a loss of muscle mass and strength, leading to decreased mobility and quality of life.

In preclinical studies, Taldefgrobep alfa Biosimilar has shown promising results in promoting muscle growth and improving muscle function in animal models of muscular dystrophy and sarcopenia. It has also been shown to be well-tolerated and safe in these studies.

In addition to its potential as a therapeutic for muscle wasting disorders, Taldefgrobep alfa Biosimilar may also have applications in other conditions where GDF-8 plays a role. For example, GDF-8 has been implicated in the development of obesity and diabetes, and Taldefgrobep alfa Biosimilar could potentially be used to target these conditions as well.

The Future of Taldefgrobep alfa Biosimilar

Taldefgrobep alfa Biosimilar is currently in the early stages of clinical development. Several phase 1 clinical trials have been completed, and a phase 2 trial is currently ongoing in patients with Duchenne muscular dystrophy.

If successful, Taldefgrobep alfa Biosimilar could provide a much-needed treatment option for patients with muscle wasting disorders and potentially other conditions where GDF-8 is involved. Its unique structure and mechanism of action make it a promising candidate for further development and could potentially improve the lives of patients with these debilitating conditions.

SDS-PAGE for Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

SDS-PAGE for Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Taldefgrobep alfa Biosimilar - Anti-GDF-8 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Taldefgrobep alfa Biosimilar – Anti-GDF-8 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products