Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Thy-1 membrane glycoprotein(THY1)

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P04216
Molecular weight:
22-30kDa(14.55 kDa)

Original price was: $280.00.Current price is: $250.00.

50ug 11% OFF + 250 loyalty points
Met1–Cys130 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Thy-1 membrane glycoprotein(THY1)

Product name Thy-1 membrane glycoprotein(THY1)
Uniprot ID P04216
Uniprot link https://www.uniprot.org/uniprot/P04216
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Molecular weight 22-30kDa(14.55 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Cys130
Protein Accession P04216
Spec:Entrez GeneID 7070
Spec:NCBI Gene Aliases CD90; CDw90
Spec:SwissProtID Q9NSP1
NCBI Reference P04216
Aliases /Synonyms CDw90,Thy-1 antigen, CD90
Reference PX-P4582
Note For research use only
Molecular Constructor
Met1–Cys130 His
Product name Thy-1 membrane glycoprotein(THY1)
Uniprot ID P04216
Uniprot link https://www.uniprot.org/uniprot/P04216
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Molecular weight 22-30kDa(14.55 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Cys130
Protein Accession P04216
Spec:Entrez GeneID 7070
Spec:NCBI Gene Aliases CD90; CDw90
Spec:SwissProtID Q9NSP1
NCBI Reference P04216
Aliases /Synonyms CDw90,Thy-1 antigen, CD90
Reference PX-P4582
Note For research use only
Molecular Constructor
Met1–Cys130 His
Product name PX-P4582-1MG
Uniprot ID P04216
Uniprot link https://www.uniprot.org/uniprot/P04216
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
Molecular weight 22-30kDa(14.55 kDa)
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Cys130
Protein Accession P04216
Spec:Entrez GeneID 7070
Spec:NCBI Gene Aliases CD90; CDw90
Spec:SwissProtID Q9NSP1
NCBI Reference P04216
Aliases /Synonyms CDw90,Thy-1 antigen, CD90
Reference PX-P4582
Note For research use only
Molecular Constructor
Met1–Cys130 His

Thy-1 membrane glycoprotein(THY1)

There are no reviews yet.

Be the first to review “Thy-1 membrane glycoprotein(THY1)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products