Cart (0 Items)
Your cart is currently empty.
View Products🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25
📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools
Explore Now
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Transaldolase(TALDO1) |
|---|---|
| Uniprot ID | P37837 |
| Uniprot link | https://www.uniprot.org/uniprot/P37837 |
| Expression system | Prokaryotic expression |
| Sequence | MGMSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGRKLGGSQED QIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRILIKLSSTWEGIQAGKELEE QHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLEDPGVKSVTKIYNYYKKFSYKTIVMGASF RNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQASDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAAD AVKLERMLTERMFNAENGKGSHHHHHH |
| Molecular weight | 38.7kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Lys337 |
| Protein Accession | P37837 |
| Spec:Entrez GeneID | 6888 |
| Spec:NCBI Gene Aliases | TAL; TALH; TAL-H; TALDOR |
| Spec:SwissProtID | Q8WV32 |
| NCBI Reference | P37837 |
| Aliases /Synonyms | TAL, TALDO, TALDOR |
| Reference | PX-P4816 |
| Note | For research use only |
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.