Cart (0 Items)
Your cart is currently empty.
View Products🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25
📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools
Explore Nowsize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Escherichia coli (E. coli) |
Applications | Elisa, WB |
Product name | Transferrin receptor protein 1(TFRC) |
---|---|
Uniprot ID | P02786 |
Uniprot link | https://www.uniprot.org/uniprot/P02786 |
Origin species | Homo sapiens (Human) |
Expression system | Prokaryotic expression |
Sequence | QNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATS RLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAF NETLFRNQLALATWTIQGAANALSG |
Molecular weight | 27.59 kDa |
Protein delivered with Tag? | N terminus His tag |
Purity estimated | >90% by SDS-PAGE |
Buffer | PBS pH 7.5, 0.02% SKL |
Delivery condition | Dry Ice |
Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Escherichia coli (E.coli) |
Fragment Type | Gln511-Gly751 |
Protein Accession | P02786 |
Spec:Entrez GeneID | 7037 |
Spec:NCBI Gene Aliases | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 |
Spec:SwissProtID | Q9UK21 |
NCBI Reference | P02786 |
Aliases /Synonyms | TR,TfR,TfR1,Trfr,T9,p90,CD_antigen: CD71 |
Reference | PX-P4795 |
Note | For research use only |
Transferrin receptor protein 1 (TFRC) on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.