Cart (0 Items)
Your cart is currently empty.
View Products🚀 Special Offer🚀Get 25% off on your bioreagent online order (except Micelles and Nanodiscs), with the code: PROTEOSHOP25
📢 New ! Accelerate your Antibody Development with Ready-to-use Stable Cell Pools
Explore Now
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Transferrin receptor protein 1(TFRC) |
|---|---|
| Uniprot ID | P02786 |
| Uniprot link | https://www.uniprot.org/uniprot/P02786 |
| Origin species | Homo sapiens (Human) |
| Expression system | Prokaryotic expression |
| Sequence | QNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPE LNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATS RLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAF NETLFRNQLALATWTIQGAANALSG |
| Molecular weight | 27.59 kDa |
| Protein delivered with Tag? | N terminus His tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS pH 7.5, 0.02% SKL |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Gln511-Gly751 |
| Protein Accession | P02786 |
| Spec:Entrez GeneID | 7037 |
| Spec:NCBI Gene Aliases | T9; TR; TFR; p90; CD71; TFR1; TRFR; IMD46 |
| Spec:SwissProtID | Q9UK21 |
| NCBI Reference | P02786 |
| Aliases /Synonyms | TR,TfR,TfR1,Trfr,T9,p90,CD_antigen: CD71 |
| Reference | PX-P4795 |
| Note | For research use only |
Transferrin receptor protein 1 (TFRC) on SDS-PAGE under reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the protein antibody is superior than 90 %.
Related products
Send us a message from the form below
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.