Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anti-Chick LYZ/Lysozyme C VHH (SAA0900)

Note:
For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anti-Chick LYZ/Lysozyme C VHH (SAA0900)

Product name Anti-Chick LYZ/Lysozyme C VHH (SAA0900)
Uniprot ID P00698
Raw Antigen Sequence MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Gallus gallus (Chicken)
Aliases /Synonyms anti-Lysozyme C, anti-3.2.1.17, anti-1,4-beta-N-acetylmuramidase C, anti-Allergen Gal d IV, anti-Gal d 4, anti-LYZ
Reference ARO-A16529
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen LYZ/Lysozyme C
Clone Name SAA0900
Target species Anti-Gallus gallus (Chicken) Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

SDS-PAGE for Anti-Chick LYZ/Lysozyme C VHH (SAA0900)

SDS-PAGE for Anti-Chick LYZ/Lysozyme C VHH (SAA0900)

Anti-Chick LYZ/Lysozyme C VHH (SAA0900), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Chick LYZ/Lysozyme C VHH (SAA0900)

There are no reviews yet.

Be the first to review “Anti-Chick LYZ/Lysozyme C VHH (SAA0900)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products