Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

  • ARO-A16428-100
  • Validated ELISA
Note:
For research use only. Not suitable for human use.

Original price was: $570.00.Current price is: $452.00.

100ug 21% OFF + 452 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) in ELISA Assay
SDS-PAGE for Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)
Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

Product name ARO-A16428-100
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16428-1MG
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16428-50
Uniprot ID P23510
Raw Antigen Sequence MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-CD252, anti-OX40L, anti-TXGP1, anti-OX40 ligand, anti-Glycoprotein Gp34, anti-TAX transcriptionally-activated glycoprotein 1, anti-TNFSF4, anti-Tumor necrosis factor ligand superfamily member 4
Reference ARO-A16428
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen CD252/TNFSF4/OX40L
Clone Name SAA1277
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) in ELISA Assay

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) in ELISA Assay

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277) can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

SDS-PAGE for Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)

There are no reviews yet.

Be the first to review “Anti-Human CD252/TNFSF4/OX40L VHH (SAA1277)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products