Brand: ProteoGenix

Anti-Human FOS VHH (SAA1335)

ARO-A16487
Quality Chart

Note:: For research use only. Not suitable for human use.

$452.00

100ug + 452 loyalty points

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

SDS-PAGE for Anti-Human FOS VHH (SAA1335)

Datasheet

Anti-Human FOS VHH (SAA1335)

Product name	Anti-Human FOS VHH (SAA1335)
Uniprot ID	P01100
Raw Antigen Sequence	MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Form	0.01M PBS, pH 7.4.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Host species	XtenCHO
Reactivity	Human
Aliases /Synonyms	anti-Cellular oncogene fos, anti-G0S7, anti-FOS, anti-G0/G1 switch regulatory protein 7, anti-Proto-oncogene c-Fos
Reference	ARO-A16487
Note	For research use only. Not suitable for human use.
Isotype	VHH-8His-Cys-tag
Clonality	Monoclonal Antibody
Immunogen	FOS
Clone Name	SAA1335
Target species	Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Datasheet

SDS-PAGE for Anti-Human FOS VHH (SAA1335)

Anti-Human FOS VHH (SAA1335), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

There are no reviews yet.

Be the first to review “Anti-Human FOS VHH (SAA1335)”

Your email address will not be published. Required fields are marked *

Your rating *

In which application did you use the antibody? *

Did it work in your application? * Yes No

Your review *

Name *

Email *

Anti-Human FOS VHH (SAA1335)

Anti-Human FOS VHH (SAA1335)

SDS-PAGE for Anti-Human FOS VHH (SAA1335)

Related products

Proto-oncogene c-Fos(FOS)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human FOS VHH (SAA1335)

Specifications Anti-Human FOS VHH (SAA1335)

Description

Documents

QC & Validation

SDS-PAGE for Anti-Human FOS VHH (SAA1335)

3D Representation

Reviews

Related products

Proto-oncogene c-Fos(FOS)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Anti-Human FOS VHH (SAA1335)