Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Anti-Human SNCA/Alpha-synuclein VHH (SAA1198)

Note:
For research use only. Not suitable for human use.

Original price was: $601.00.Current price is: $452.00.

100ug 25% OFF + 452 loyalty points
Size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Anti-Human SNCA/Alpha-synuclein VHH (SAA1198)

Anti-Human SNCA/Alpha-synuclein VHH (SAA1198)

Product name ARO-A16412-100
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Alpha-synuclein, anti-PARK1, anti-Non-A4 component of amyloid precursor, anti-NACP, anti-Non-A beta component of AD amyloid, anti-SNCA
Reference ARO-A16412
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen SNCA/Alpha-synuclein
Clone Name SAA1198
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16412-1MG
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Alpha-synuclein, anti-PARK1, anti-Non-A4 component of amyloid precursor, anti-NACP, anti-Non-A beta component of AD amyloid, anti-SNCA
Reference ARO-A16412
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen SNCA/Alpha-synuclein
Clone Name SAA1198
Target species Anti-Human Monoclonal Antibody
Product name ARO-A16412-50
Uniprot ID P37840
Raw Antigen Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Form 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species XtenCHO
Reactivity Human
Aliases /Synonyms anti-Alpha-synuclein, anti-PARK1, anti-Non-A4 component of amyloid precursor, anti-NACP, anti-Non-A beta component of AD amyloid, anti-SNCA
Reference ARO-A16412
Note For research use only. Not suitable for human use.
Isotype VHH-8His-Cys-tag
Clonality Monoclonal Antibody
Immunogen SNCA/Alpha-synuclein
Clone Name SAA1198
Target species Anti-Human Monoclonal Antibody

For research use only. Not suitable for human use.
*NANOBODY® compound or NANOBODIES® compounds are registered trademarks of Ablynx N.V.

Anti-Human SNCA/Alpha-synuclein VHH (SAA1198)

There are no reviews yet.

Be the first to review “Anti-Human SNCA/Alpha-synuclein VHH (SAA1198)”

Your email address will not be published. Required fields are marked *

Related products

  • Alpha-synuclein(SNCA)

    PX-P4717

    Alpha-synuclein(SNCA)

    Original price was: $474.00.Current price is: $392.00.
    View Product

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products