Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Fibronectin(FN1)AZN
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Fibronectin(FN1)AZN |
|---|---|
| Uniprot ID | P02751 |
| Uniprot link | https://www.uniprot.org/uniprot/P02751 |
| Expression system | Prokaryotic expression |
| Sequence | MEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSG ESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYT VSVVALHDDMESQPLIGTQSTAAALEHHHHHH |
| Molecular weight | 20.9kDa |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90% by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Glu1632-Ala1812 |
| Protein Accession | P02751 |
| Spec:Entrez GeneID | 2335 |
| Spec:NCBI Gene Aliases | FN; CIG; FNZ; MSF; ED-B; FINC; GFND; LETS; GFND2; SMDCF |
| Spec:SwissProtID | Q14312 |
| NCBI Reference | P02751 |
| Aliases /Synonyms | Cold-insoluble globulin,CIG,FN |
| Reference | PX-P4840 |
| Note | For research use only |
Related products
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.