Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade

Product name Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1043-50
Uniprot ID P01579
Source CAS 326859-36-3
Species Humanized
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Fontolizumab,HuZAF,IFNG,anti-IFNG
Reference PX-TA1043
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade

Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade: A Promising Antibody for Therapeutic Targeting

Introduction

Fontolizumab Biosimilar, also known as Anti-IFNG mAb, is a monoclonal antibody that targets the cytokine interferon-gamma (IFNG). This antibody is a biosimilar of the originator drug, Fontolizumab, and is currently in the research grade stage. It is being developed as a potential therapeutic option for various autoimmune and inflammatory diseases, including Crohn’s disease, rheumatoid arthritis, and psoriasis.

Structure of Fontolizumab Biosimilar

Fontolizumab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target molecule, IFNG, while the constant region determines the antibody’s effector functions.

The variable region of Fontolizumab Biosimilar is created by combining the genetic sequences of the variable regions of human and murine antibodies. This allows the antibody to have a high specificity and affinity for IFNG, while also reducing the risk of immunogenicity in patients.

Mechanism of Action

Fontolizumab Biosimilar binds to IFNG with high specificity and affinity, preventing it from binding to its receptor and exerting its pro-inflammatory effects. This leads to a decrease in the production of pro-inflammatory cytokines and chemokines, as well as a reduction in the activation of immune cells, such as T cells and macrophages. This ultimately results in a decrease in inflammation and tissue damage.

In addition to its direct effects on IFNG, Fontolizumab Biosimilar also has an indirect mechanism of action through its Fc region. This region can interact with Fc receptors on immune cells, triggering various effector functions, such as antibody-dependent cellular cytotoxicity and antibody-dependent cellular phagocytosis. These functions can help to further reduce inflammation and promote tissue repair.

Applications of Fontolizumab Biosimilar

Fontolizumab Biosimilar is being investigated for its potential use in various autoimmune and inflammatory diseases. Some of the key applications of this antibody include:

Crohn’s Disease Crohn’s disease is a chronic inflammatory bowel disease that affects the gastrointestinal tract. It is characterized by inflammation, ulceration, and scarring of the intestinal wall. Fontolizumab Biosimilar has shown promising results in clinical trials for the treatment of Crohn’s disease, with a significant reduction in disease activity and improvement in symptoms.

Rheumatoid Arthritis

Rheumatoid arthritis is a chronic autoimmune disease that primarily affects the joints. It is characterized by inflammation, pain, and joint damage. Fontolizumab Biosimilar has shown potential as a treatment option for rheumatoid arthritis, with studies demonstrating a decrease in disease activity and improvement in joint function.

Psoriasis

Psoriasis is a chronic inflammatory skin disease that is characterized by red, scaly patches on the skin. It is caused by an overactive immune response. Fontolizumab Biosimilar has shown promising results in clinical trials for the treatment of psoriasis, with a significant reduction in skin lesions and improvement in symptoms.

Conclusion

Fontolizumab Biosimilar is a promising antibody for therapeutic targeting of IFNG in various autoimmune and inflammatory diseases. Its unique structure and mechanism of action make it a potential treatment option for patients who do not respond to traditional therapies. With

SDS-PAGE for Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade

SDS-PAGE for Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade

Fontolizumab Biosimilar - Anti-IFNG;IFN-gamma mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Fontolizumab Biosimilar - Anti-IFNG mAb - Research Grade

There are no reviews yet.

Be the first to review “Fontolizumab Biosimilar – Anti-IFNG mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products