Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade

  • PX-TA1037-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade

Product name Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1037-50
Uniprot ID P01911
Source CAS 267227-08-7
Species Humanized
Raw Antigen Sequence MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Apolizumab,Hu1D10,HLA-DRB,anti-HLA-DRB
Reference PX-TA1037
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction to Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade

Apolizumab Biosimilar, also known as Anti-HLA-DRB monoclonal antibody (mAb), is a research grade therapeutic antibody that targets the human leukocyte antigen DRB (HLA-DRB). This antibody has been developed as a biosimilar to the existing drug Apolizumab, which is used for the treatment of autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. In this article, we will discuss the structure, activity, and potential applications of Apolizumab Biosimilar in scientific research.

Structure of Apolizumab Biosimilar

Apolizumab Biosimilar is a monoclonal antibody, which means it is produced by a single clone of cells and is highly specific for its target antigen. The antibody is composed of two heavy chains and two light chains, joined together by disulfide bonds. The heavy chains consist of a constant region and a variable region, while the light chains have only a variable region. The variable regions of both the heavy and light chains are responsible for binding to the target antigen, HLA-DRB.

The structure of Apolizumab Biosimilar is similar to the original drug, Apolizumab, as it is a biosimilar. However, there may be slight differences in the amino acid sequence of the antibody, which do not affect its binding specificity and activity.

Activity of Apolizumab Biosimilar

Apolizumab Biosimilar has a high affinity for the HLA-DRB antigen, which is expressed on the surface of antigen-presenting cells (APCs). This antigen is involved in the immune response and plays a crucial role in the development of autoimmune diseases. By binding to HLA-DRB, Apolizumab Biosimilar inhibits the interaction between APCs and T cells, which prevents the activation of the immune response.

In addition to its inhibitory effect on the immune response, Apolizumab Biosimilar also has anti-inflammatory properties. It can block the production of pro-inflammatory cytokines, such as TNF-alpha and IL-6, which are involved in the pathogenesis of autoimmune diseases. This dual mechanism of action makes Apolizumab Biosimilar a promising therapeutic agent for the treatment of autoimmune diseases.

Applications of Apolizumab Biosimilar

Apolizumab Biosimilar is primarily used in scientific research for the development of new treatments for autoimmune diseases. It can be used to study the role of HLA-DRB in the immune response and to investigate the potential of targeting this antigen for the treatment of autoimmune diseases. The biosimilar can also be used in preclinical studies to evaluate its efficacy and safety in comparison to the original drug, Apolizumab.

In addition, Apolizumab Biosimilar can also be used as a tool in diagnostic assays for the detection of HLA-DRB. This can aid in the diagnosis and monitoring of autoimmune diseases, as well as in the selection of appropriate treatments for individual patients.

Conclusion

Apolizumab Biosimilar is a research grade therapeutic antibody that specifically targets HLA-DRB, an antigen involved in the immune response and the development of autoimmune diseases. Its structure and activity are similar to the original drug, Apolizumab, and it has potential applications in scientific research and diagnostic assays. With further studies, Apolizumab Biosimilar may prove to be a valuable addition to the arsenal of treatments for autoimmune diseases.

SDS-PAGE for Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

SDS-PAGE for Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade in ELISA Assay

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade in ELISA Assay

Apolizumab Biosimilar - Anti-HLA-DRB1 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Apolizumab Biosimilar - Anti-HLA-DRB mAb - Research Grade

There are no reviews yet.

Be the first to review “Apolizumab Biosimilar – Anti-HLA-DRB mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products