Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Zolimomab Biosimilar – Anti-CD5 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1-nd

Original price was: $317.00.Current price is: $238.00.

100ug 25% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

Product name Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Expression system Mammalian cells
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody
Product name PX-TA1226-50
Uniprot ID P06127
Source CAS 141483-72-9
Species Mus musculus
Raw Antigen Sequence MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Zolimomab,H65-ricin A chain immunotoxin,H65-RTA,CD5,anti-CD5
Reference PX-TA1226
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-nd
Clonality Monoclonal Antibody

Introduction

Zolimomab Biosimilar, also known as Anti-CD5 monoclonal antibody (mAb), is a research grade therapeutic antibody that has been developed as a biosimilar to the original drug, Zolimomab, which was approved for clinical use in 1995. Zolimomab Biosimilar is a highly specific antibody that targets CD5, a cell surface protein that is expressed on T cells and B cells. In this article, we will discuss the structure, activity, and potential applications of Zolimomab Biosimilar.

Structure of Zolimomab Biosimilar

Zolimomab Biosimilar is a recombinant, humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to CD5, while the constant region determines the effector functions of the antibody. Zolimomab Biosimilar is produced using recombinant DNA technology, making it a highly pure and consistent product.

Activity of Zolimomab Biosimilar

Zolimomab Biosimilar binds specifically to the CD5 protein on the surface of T cells and B cells. CD5 is a co-receptor that is involved in the activation and proliferation of these immune cells. By binding to CD5, Zolimomab Biosimilar blocks its interaction with other molecules, leading to the inhibition of immune cell activation. This can be beneficial in autoimmune disorders, where the immune system is overactive and attacks healthy cells and tissues.

Potential Applications of Zolimomab Biosimilar Zolimomab Biosimilar has potential applications in the treatment of various

autoimmune disorders, such as rheumatoid arthritis, psoriasis, and multiple sclerosis. By targeting CD5, Zolimomab Biosimilar can modulate the activity of immune cells and reduce inflammation, which is a common feature of these diseases. Additionally, Zolimomab Biosimilar may also be useful in preventing organ rejection in transplant patients, as CD5 is involved in the immune response to foreign tissue.

Advantages of Zolimomab Biosimilar

As a biosimilar, Zolimomab Biosimilar has several advantages over the original drug, Zolimomab. Firstly, it is more cost-effective, as the production process is less expensive. This makes it more accessible to patients who may not be able to afford the original drug. Secondly, Zolimomab Biosimilar has a lower risk of adverse effects, as it is produced using advanced technology and has undergone rigorous testing to ensure its safety and efficacy.

Conclusion

In summary, Zolimomab Biosimilar is a research grade therapeutic antibody that targets CD5, a protein involved in immune cell activation. Its structure, activity, and potential applications make it a promising candidate for the treatment of autoimmune disorders and prevention of organ rejection. As a biosimilar, Zolimomab Biosimilar offers several advantages over the original drug, making it a cost-effective and safe option for patients. Further research and clinical trials are needed to fully explore the potential of Zolimomab Biosimilar in the field of immunotherapy.

SDS-PAGE for Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

SDS-PAGE for Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Zolimomab Biosimilar - Anti-CD5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Zolimomab Biosimilar – Anti-CD5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products