Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Emapalumab Biosimilar – Anti-IFNG mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, lambda

Original price was: $201.00.Current price is: $167.00.

50ug 17% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade

Product name Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 1709815-23-5
Species Homo sapiens
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Emapalumab,NI-0501,emapalumab-lzsg,IFNG ,anti-IFNG
Reference PX-TA1450
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade
Uniprot ID P01579
Source CAS 1709815-23-5
Species Homo sapiens
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Emapalumab,NI-0501,emapalumab-lzsg,IFNG ,anti-IFNG
Reference PX-TA1450
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-lambda
Clonality Monoclonal Antibody
Product name PX-TA1450-50
Uniprot ID P01579
Source CAS 1709815-23-5
Species Homo sapiens
Raw Antigen Sequence MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Emapalumab,NI-0501,emapalumab-lzsg,IFNG ,anti-IFNG
Reference PX-TA1450
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, lambda
Clonality Monoclonal Antibody

Introduction

Emapalumab Biosimilar, also known as Anti-IFNG mAb, is a monoclonal antibody that specifically targets and inhibits the activity of interferon-gamma (IFNG), a pro-inflammatory cytokine involved in various immune responses. This biosimilar has been developed as a potential therapeutic agent for various inflammatory and autoimmune diseases.

Structure of Emapalumab Biosimilar

Emapalumab Biosimilar is a recombinant humanized monoclonal antibody, meaning it is produced using genetic engineering techniques to create a molecule with both human and non-human components. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable regions of the antibody are responsible for binding to IFNG, while the constant regions determine the antibody’s effector functions.

Mechanism of Action

Emapalumab Biosimilar works by binding to IFNG and preventing it from binding to its receptor on immune cells. This blocks the downstream signaling pathways that lead to inflammation and immune responses. Additionally, the antibody also promotes the clearance of IFNG from the bloodstream, further reducing its activity.

Therapeutic Applications

Emapalumab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for its potential therapeutic applications. Some of the diseases that this biosimilar is being investigated for include:

1. Inflammatory Bowel Disease (IBD) IFNG has been implicated in the pathogenesis of IBD, a group of chronic inflammatory disorders of the gastrointestinal tract. Emapalumab Biosimilar has shown to effectively reduce inflammation in animal models of IBD, making it a potential therapeutic option for this disease.

2. Rheumatoid Arthritis Rheumatoid arthritis (RA) is an autoimmune disorder characterized by chronic inflammation and joint damage. IFNG is known to contribute to the progression of RA, and Emapalumab Biosimilar has shown to improve symptoms and reduce joint damage in preclinical studies.

3. Psoriasis Psoriasis is a chronic inflammatory skin disorder, and IFNG is one of the key cytokines involved in its pathogenesis. Emapalumab Biosimilar has been shown to effectively reduce skin inflammation and improve the symptoms of psoriasis in preclinical studies.

4. Multiple Sclerosis Multiple sclerosis (MS) is an autoimmune disorder in which the immune system attacks the central nervous system. IFNG has been implicated in the development and progression of MS, and Emapalumab Biosimilar has shown to reduce inflammation and improve symptoms in animal models of MS.

Research Grade Emapalumab Biosimilar

Apart from its potential therapeutic applications, Emapalumab Biosimilar is also available in a research grade for use in laboratory studies. This grade of the antibody is highly pure and has been extensively characterized for its specificity and activity against IFNG. It is an essential tool for researchers studying the role of IFNG in various diseases and developing new treatments.

Conclusion

In summary, Emapalumab Biosimilar is a promising monoclonal antibody that specifically targets and inhibits the activity of IFNG. Its structure, mechanism of action, and potential therapeutic applications make it a valuable tool for both research and clinical use. As more studies are conducted, it is hoped that this biosimilar will provide a safe and effective treatment option for various inflammatory and autoimmune diseases.

SDS-PAGE for Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade

SDS-PAGE for Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade

Emapalumab Biosimilar - Anti-IFNG mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Emapalumab Biosimilar - Anti-IFNG  mAb - Research Grade

There are no reviews yet.

Be the first to review “Emapalumab Biosimilar – Anti-IFNG mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products