Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human AMH,Muellerian-inhibiting factor recombinant protein
| Size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human AMH,Muellerian-inhibiting factor recombinant protein |
|---|---|
| Uniprot ID | P03971 |
| Uniprot link | http://www.uniprot.org/uniprot/P03971 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAW LRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHRCFTR MTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDPAPLHDPTSAPW ATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGDPLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGW PQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCRSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 85.45kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 80% |
| Buffer | PBS, pH 7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| Aliases /Synonyms | MIF, MIH, MIS, Müllerian Inhibiting Factor, Müllerian Inhibiting Hormone, Müllerian Inhibiting Substance, AMH |
| Reference | PX-P4055 |
| Note | For research use only |
Description of Human AMH,Muellerian-inhibiting factor recombinant protein
General Information about Human AMH/Muellerian-inhibiting factor recombinant protein
This glycoprotein produced by Sertoli cells can cause the degeneration of the Muellerian ducts. It can also prevent the growth of tumors derived from Mueller’s canal origin tissue. Although it does not compete with EGF for receptor binding sites, MIS can prevent EGF receptor autophosphorylation in vitro. GO-molecular function,
Related products
Biosimilar
Tefibazumab Biosimilar – Anti-Fibrin-binding surface epitope clumping factor A mAb – Research Grade
PX-TA1187 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.