Brand: ProteoGenix

Human AMH,Muellerian-inhibiting factor recombinant protein

PX-P4055-50
Quality Chart

Host species:: Mammalian cells
Origin species:: Homo sapiens (Human)
Uniprot ID:: P03971
Molecular weight:: 85.45kDa

$250.00

50ug + 250 loyalty points

Full-length Yes

size size

50ug $250.00
100ug $500.00

First Name This field is required. Last Name This field is required. Email This field is required. Company This field is required. Country This field is required. State This field is required.

In Stock
Wide range of unique reagents
Fast worldwide delivery

Human AMH,Muellerian-inhibiting factor recombinant protein

Product name	Human AMH, Muellerian-inhibiting factor recombinant protein
Uniprot ID	P03971
Uniprot link	http://www.uniprot.org/uniprot/P03971
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAW LRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHRCFTR MTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDPAPLHDPTSAPW ATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGDPLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGW PQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCRSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	85.45kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
Aliases /Synonyms	MIF, MIH, MIS, Müllerian Inhibiting Factor, Müllerian Inhibiting Hormone, Müllerian Inhibiting Substance, AMH
Reference	PX-P4055
Note	For research use only
Molecular Constructor	Full-length Yes

Product name	Human AMH,Muellerian-inhibiting factor recombinant protein
Uniprot ID	P03971
Uniprot link	http://www.uniprot.org/uniprot/P03971
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPLRVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAW LRDPGGQRLVVLHLEEVTWEPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGSGLALTLQPRGEDSRLSTARLQALLFGDDHRCFTR MTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAELEESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLLRPTAATTGDPAPLHDPTSAPW ATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGDPLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGW PQSDRNPRYGNHVVLLLKMQARGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCRSRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	85.45kDa
Protein delivered with Tag?	Yes
Purity estimated	80%
Buffer	PBS, pH 7.5
Form	Lyophilized
Delivery condition	Dry Ice
Delivery lead time in business days	5-7
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Fragment Type	Full-length
Aliases /Synonyms	MIF, MIH, MIS, Müllerian Inhibiting Factor, Müllerian Inhibiting Hormone, Müllerian Inhibiting Substance, AMH
Reference	PX-P4055
Note	For research use only
Molecular Constructor	Full-length Yes

General Information about Human AMH/Muellerian-inhibiting factor recombinant protein

This glycoprotein produced by Sertoli cells can cause the degeneration of the Muellerian ducts. It can also prevent the growth of tumors derived from Mueller’s canal origin tissue. Although it does not compete with EGF for receptor binding sites, MIS can prevent EGF receptor autophosphorylation in vitro. GO-molecular function,

There are no reviews yet.

Be the first to review “Human AMH,Muellerian-inhibiting factor recombinant protein”

Human AMH,Muellerian-inhibiting factor recombinant protein

Human AMH,Muellerian-inhibiting factor recombinant protein

General Information about Human AMH/Muellerian-inhibiting factor recombinant protein

Related products

Tefibazumab Biosimilar – Anti-Fibrin-binding surface epitope clumping factor A mAb – Research Grade

Lampalizumab Biosimilar – Anti-CFD mAb – Research Grade

Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade

Licaminlimab Biosimilar – Anti-TNFA mAb – Research Grade

Nadecnemab Biosimilar – Anti-GFRA3 mAb – Research Grade

Pimurutamab Biosimilar – Anti-EGFR mAb – Research Grade

Plonmarlimab Biosimilar – Anti-CSF2 mAb – Research Grade

VAK-694 Biosimilar – Anti-Binetrakin mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

Zatuximab Biosimilar – Anti-HER1 mAb – Research Grade

Pogalizumab Biosimilar – Anti-ACT35 antigen mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

LY3022855 Biosimilar – Anti-CD115 mAb – Research Grade

EGFR protein – Epidermal growth factor receptor(EGFR)

CD40 ligand(CD40LG)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human AMH,Muellerian-inhibiting factor recombinant protein

Specifications Human AMH,Muellerian-inhibiting factor recombinant protein

Description

General Information about Human AMH/Muellerian-inhibiting factor recombinant protein

Documents

Reviews

Related products

Tefibazumab Biosimilar – Anti-Fibrin-binding surface epitope clumping factor A mAb – Research Grade

Lampalizumab Biosimilar – Anti-CFD mAb – Research Grade

Barecetamab Biosimilar – Anti-ERBB3 mAb – Research Grade

Licaminlimab Biosimilar – Anti-TNFA mAb – Research Grade

Nadecnemab Biosimilar – Anti-GFRA3 mAb – Research Grade

Pimurutamab Biosimilar – Anti-EGFR mAb – Research Grade

Plonmarlimab Biosimilar – Anti-CSF2 mAb – Research Grade

VAK-694 Biosimilar – Anti-Binetrakin mAb – Research Grade

CM101 Biosimilar – Anti-MPIF2 mAb – Research Grade

Zatuximab Biosimilar – Anti-HER1 mAb – Research Grade

Pogalizumab Biosimilar – Anti-ACT35 antigen mAb – Research Grade

Toralizumab Biosimilar – Anti-sCD40L mAb – Research Grade

LY3022855 Biosimilar – Anti-CD115 mAb – Research Grade

EGFR protein – Epidermal growth factor receptor(EGFR)

CD40 ligand(CD40LG)

Recently viewed products

Can’t find what you need?

Cart (0 Items)

Human AMH,Muellerian-inhibiting factor recombinant protein