Cart (0 Items)
Your cart is currently empty.
View Products-
-
-
Human Beta-nerve growth factor recombinant protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Mammalian cells |
| Applications | Elisa, WB |
| Product name | Human Beta-nerve growth factor recombinant protein |
|---|---|
| Uniprot ID | P01138 |
| Uniprot link | http://www.uniprot.org/uniprot/P01138 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Sequence | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRASRDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 53.31kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 70% |
| Buffer | 0.1M Tris-HCl, 0.1M Glycine, pH=7.5 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| Aliases /Synonyms | NGF, NGFB, Beta-NGF, HSAN5, NGF-B, Beta-Nerve Growth Factor proteins |
| Reference | PX-P4027 |
| Note | For research use only |
Related products
Biosimilar
Tefibazumab Biosimilar – Anti-Fibrin-binding surface epitope clumping factor A mAb – Research Grade
PX-TA1187 238$
Contact us
Send us a message from the form below
Reviews
There are no reviews yet.