Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human EPO recombinant protein

Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
P01588
Molecular weight:
24.39 kDa

Original price was: $501.00.Current price is: $451.00.

100ug 10% OFF + 451 loyalty points
Met1–Arg193 Strep
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human EPO recombinant protein

Human EPO recombinant protein

Product name PX-P6548-100
Uniprot ID P01588
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Molecular weight 24.39 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg193
Aliases /Synonyms Erythropoietin, EpoetinEPO,
Reference PX-P6548
Molecular Constructor
Met1–Arg193 Strep
Product name PX-P6548-1MG
Uniprot ID P01588
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Molecular weight 24.39 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg193
Aliases /Synonyms Erythropoietin, EpoetinEPO,
Reference PX-P6548
Molecular Constructor
Met1–Arg193 Strep
Product name PX-P6548-50
Uniprot ID P01588
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Molecular weight 24.39 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg193
Aliases /Synonyms Erythropoietin, EpoetinEPO,
Reference PX-P6548
Molecular Constructor
Met1–Arg193 Strep

There are no reviews yet.

Be the first to review “Human EPO recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products